Gene Information

Name : Galf_2041 (Galf_2041)
Accession : YP_003847811.1
Strain : Gallionella capsiferriformans ES-2
Genome accession: NC_014394
Putative virulence/resistance : Unknown
Product : integrase family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 2209938 - 2211152 bp
Length : 1215 bp
Strand : -
Note : PFAM: integrase family protein; KEGG: rso:RSc0968 cp4-like integrase protein

DNA sequence :
ATGAAGTTGTCCGATGCAGCGGTGAAGAAAGCTAAACCCGAAGCCAAGCCATATAAATTGGCGGATGGGGACGGAATGTA
TATTGAAGTCATGCCCAGTGGCTCAAAATACTGGCGGCTTAAATATCGCTATGCCGGAAAAGAAAAGAGGCTTGCACTGG
GTGTATATCCAGAAGTGAGCCTAAAAGATGCACGGGAACGGCGCGACGCTGCGCGCAAGCTGATAGCCAACGGCACAGAC
CCAGGCGAAGCCAAACAAGCCCAAAAGCGCGAGGGCAAGATAGCGGCGGCGAATACCTTCGAGGCTGTGGCGCGTGAATG
GGTTGAGAATAGATCGAATGACTGGACGGCAGGCCACAAGGCGCTGACGCTGCGCACACTGGAGCAGGACGCATTCCCGT
CTATTGGTCGCCGCCCTATCGCTGAAATATCATCATCTGAGGTATTGGCAACGGTGCGTGCCATTGAGAAACGCGGGGCG
CTGGAGATTGCCGGCCGTGTCTTGCAACGATGCAGTGCTGTTTTTCGTTATGCCATCGCAACAGATCGGTGCAAAAATAA
TCCGGCCTTCAAAATGAGCGAGGCGCTCAAAAGCCCGACCCGCTCCCACTACAACACAATCGAGAAAGGCGGATTTCCGA
AACTGTTGCGCGATATTGACGGCTATCAAGGCAGTCCGATGACCACATACATCTTGCAACTCATGGCGCTGACCTTCACC
CGCACGGGCGAACTGGTAAATGCAGAGTGGAAGGAAATAGATCTTGATCGGGCGGAATGGCTAATCCCTGCTGAACGGAT
GAAGATGCGCAGGCCGCATCTTGTGCCGTTGTCCGTGCAGGCTGTGGCTGTATTCCGTGAGGCTGCGAAGTTGTCCGGTG
ATCGGGTCCATGTATTCCCGAACCGTAACGACCCAAGCCAGCCAGCCAGCAACGCCATTATTCTGCGCGCATTGGGGCGC
ATGGGTTACACGGGCAAGATGACAGGCCACGGCTTCAGATCGGCGGCCTCAACCATGCTGAACGAGAACAAAAGCAAATG
GGGTATTCACCGCGACACAATCGAATTGCAGCTCGCACACGTTGAAAAGAACGCCAGCCGTGCGGCGTACAACTTCGCTG
AATACCTTGATGAGCGCCGGACAATGATGCAGCAATGGGCTGACCATCTGGACAAGTTAAAAGCGGGTGCGGAAGTTGTG
AAGCTGCGTGCATAG

Protein sequence :
MKLSDAAVKKAKPEAKPYKLADGDGMYIEVMPSGSKYWRLKYRYAGKEKRLALGVYPEVSLKDARERRDAARKLIANGTD
PGEAKQAQKREGKIAAANTFEAVAREWVENRSNDWTAGHKALTLRTLEQDAFPSIGRRPIAEISSSEVLATVRAIEKRGA
LEIAGRVLQRCSAVFRYAIATDRCKNNPAFKMSEALKSPTRSHYNTIEKGGFPKLLRDIDGYQGSPMTTYILQLMALTFT
RTGELVNAEWKEIDLDRAEWLIPAERMKMRRPHLVPLSVQAVAVFREAAKLSGDRVHVFPNRNDPSQPASNAIILRALGR
MGYTGKMTGHGFRSAASTMLNENKSKWGIHRDTIELQLAHVEKNASRAAYNFAEYLDERRTMMQQWADHLDKLKAGAEVV
KLRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec33 AAW51716.1 Int Not tested AGI-3 Protein 8e-81 49
int AAD44730.1 Int Not tested SHI-2 Protein 5e-80 49
int CAC39282.1 integrase Not tested LPA Protein 9e-81 49
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 4e-80 49
ECs4534 NP_312561.1 integrase Not tested LEE Protein 4e-80 49
int AAC31482.1 CP4-like integrase Not tested LEE Protein 3e-80 49
int ACU09430.1 integrase Not tested LEE Protein 3e-80 49
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 1e-79 49
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 1e-79 49
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 1e-79 49
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 3e-77 48
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 2e-76 48
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 7e-67 46
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 3e-66 46
int AAK00456.1 Int Not tested SHI-1 Protein 2e-65 45
int CAC81896.1 integrase Not tested LEE II Protein 6e-65 45
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 4e-66 45
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 1e-66 45
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 1e-66 45
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 1e-66 45
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 7e-67 45
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 7e-67 45
int AAL51003.1 CP4-like integrase Not tested LEE Protein 3e-66 45
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 2e-66 45
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 1e-66 45
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 2e-66 45
int AAL51028.1 CP4-like integrase Not tested LEE Protein 1e-66 45
int-phe AAL60261.1 Int-phe Not tested LEE Protein 1e-66 45
int AAK16198.1 Int Not tested PAI-I AL862 Protein 8e-67 45
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 8e-66 45
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 8e-67 45
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 7e-67 45
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 6e-66 45
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 4e-64 44
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 6e-67 43
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 6e-67 43
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 8e-59 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Galf_2041 YP_003847811.1 integrase family protein VFG0783 Protein 2e-80 49
Galf_2041 YP_003847811.1 integrase family protein VFG0598 Protein 6e-80 49
Galf_2041 YP_003847811.1 integrase family protein VFG1693 Protein 3e-67 46
Galf_2041 YP_003847811.1 integrase family protein VFG0626 Protein 3e-67 45
Galf_2041 YP_003847811.1 integrase family protein VFG1536 Protein 2e-64 44