Gene Information

Name : Galf_1896 (Galf_1896)
Accession : YP_003847668.1
Strain : Gallionella capsiferriformans ES-2
Genome accession: NC_014394
Putative virulence/resistance : Resistance
Product : transcriptional regulator, MerR family
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2070877 - 2071377 bp
Length : 501 bp
Strand : -
Note : KEGG: pol:Bpro_4798 MerR family transcriptional regulator; PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; SMART: regulatory protein MerR

DNA sequence :
ATGAAAACGAGCAAAGCAAGTTTCGAGCAAGCGAAGCGCAGCGGCCAAACGAACAAAGCGAGTGCTCCAAAATTACAGAT
ACATGATCCGGAAAACGGCATGACCATCGGGCAATTGGCTTCGGAAGCTGGCGTAAATGTGGAAACCATTCGTTATTACC
AGCGCGAGAAATTGCTGAACACACCGAAAAGGGAATTTGGTTCGATCCGACGTTATGGTGCAGTTGAATTGAACTGTTTA
CTGTTCATCAAGCGCGCACAGGCCATTGGTTTTTCGCTGACGGAAATTTCCTTGCTGCTCAAGTTGGCCGAAGGCGAGCA
TTGCGCCGAAACAAAGAGGTTGGCCGAGAAAAAACTTGTGGTAATCAAACAAAAAATTGCGGATTTACTCTCCATAGAAT
CATCATTAGAAAAACTTATTTCCGCCTGTCGAAAAGGAAAAGGCGGCTGTGGCTGCCCGATTATTGACAGCCTGGTGGGC
GGAGAAAGAACATTGTCGTAA

Protein sequence :
MKTSKASFEQAKRSGQTNKASAPKLQIHDPENGMTIGQLASEAGVNVETIRYYQREKLLNTPKREFGSIRRYGAVELNCL
LFIKRAQAIGFSLTEISLLLKLAEGEHCAETKRLAEKKLVVIKQKIADLLSIESSLEKLISACRKGKGGCGCPIIDSLVG
GERTLS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-25 51
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 4e-25 51
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-25 51
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-25 51
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-24 50
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-24 50
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-25 50
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-25 50
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 7e-26 49
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 4e-22 46
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 4e-23 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Galf_1896 YP_003847668.1 transcriptional regulator, MerR family BAC0684 Protein 2e-26 51
Galf_1896 YP_003847668.1 transcriptional regulator, MerR family BAC0689 Protein 3e-25 51
Galf_1896 YP_003847668.1 transcriptional regulator, MerR family BAC0232 Protein 7e-26 50
Galf_1896 YP_003847668.1 transcriptional regulator, MerR family BAC0687 Protein 7e-26 50
Galf_1896 YP_003847668.1 transcriptional regulator, MerR family BAC0683 Protein 5e-26 50
Galf_1896 YP_003847668.1 transcriptional regulator, MerR family BAC0688 Protein 8e-26 50
Galf_1896 YP_003847668.1 transcriptional regulator, MerR family BAC0686 Protein 4e-26 49