Gene Information

Name : Clocel_1852 (Clocel_1852)
Accession : YP_003843360.1
Strain : Clostridium cellulovorans 743B
Genome accession: NC_014393
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2234326 - 2235030 bp
Length : 705 bp
Strand : +
Note : KEGG: cac:CAC1700 response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver; transcriptional regulator domain-containing protein

DNA sequence :
ATGGCTAAAGAAAAGATACTTATTGTTGATGATGAAGAACATATTGTTGAATTAATAAAATATAACTTAGAAGCTGAGGA
GTATAAAGTTTTAACTGCTCATGATGGAATTGAAGCTGGAAAAATAGCTAAAAAAGAAAAACCATCACTTATTCTCTTGG
ACTTAATGCTTCCAGGTATAAGTGGAATGGAAGTATGCAAAAAAATAAGAAGGGATGATGAAATTTCAGAAATTCCTATA
ATTATGCTTACAGCTAAGAGTGATGAACTTGATAAAATTCTAGGACTTGAGCTTGGAGCAGATGATTATATTACTAAGCC
ATTCTCAATTAGAGAACTGTTAGCAAGAGTTAAAGCTGTTCTAAGAAGAACTAATACAGTAGCAGTTTCAACTAATTCTA
GATTTGGAGAGTTAACTATAGATTTTAGTAAATATGAAGTGAGAAAAAATGATATTAAAGTAGATTTAACCTTAAAAGAA
TTTGAACTACTAAATATTCTAGTTAAGAATAGAGGAAAAGTTTTGACTAGGGATGTATTACTAGATAAAATTTGGGGTTA
TGAGTATATTGGAGAAACTAGAACAGTGGATGTTCACATAAGGCACCTAAGGAAAAAAATTGAGGATGATGATAGTAGTC
CAAAATATATAGAAACTATCAGGGGAATTGGATACAGGTTTAGTTACGATGAGGAAACTGTATGA

Protein sequence :
MAKEKILIVDDEEHIVELIKYNLEAEEYKVLTAHDGIEAGKIAKKEKPSLILLDLMLPGISGMEVCKKIRRDDEISEIPI
IMLTAKSDELDKILGLELGADDYITKPFSIRELLARVKAVLRRTNTVAVSTNSRFGELTIDFSKYEVRKNDIKVDLTLKE
FELLNILVKNRGKVLTRDVLLDKIWGYEYIGETRTVDVHIRHLRKKIEDDDSSPKYIETIRGIGYRFSYDEETV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 6e-34 43
kdpE BAA82188.1 KDP operon transcriptional regulatory protein KdpE Not tested Type-II SCCmec Protein 8e-32 42
kdpE YP_039536.1 response regulator protein Not tested Type-II SCCmec Protein 1e-31 42
kdpE NP_370594.1 transcriptional regulator kdpE Not tested Type-II SCCmec Protein 1e-31 42
kdpE NP_373306.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-31 42
kdeP YP_190033.1 DNA-binding response regulator KdeP Not tested Type-II SCCmec Protein 1e-31 42
SH0031 YP_251946.1 hypothetical protein Not tested SCCmec Protein 3e-32 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-42 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-31 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-41 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-54 56
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 9e-52 52
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 5e-50 51
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-52 50
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-52 50
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-52 50
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-52 50
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-52 50
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-52 50
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-52 50
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-52 50
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-52 50
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-52 50
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-49 47
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 1e-40 45
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 1e-40 45
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-38 44
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-38 44
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-38 44
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-38 44
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-38 44
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-38 44
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-38 44
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-38 44
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 5e-37 44
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-33 43
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 5e-41 43
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 9e-36 43
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 9e-37 42
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family BAC0596 Protein 2e-37 42
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 2e-37 42
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family HE999704.1.gene1202. Protein 2e-35 41
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 5e-39 41
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family BAC0039 Protein 5e-38 41
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 5e-38 41
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 4e-38 41
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 5e-37 41
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 5e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family VFG1563 Protein 3e-42 42
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-31 41
Clocel_1852 YP_003843360.1 two component transcriptional regulator, winged helix family VFG1702 Protein 4e-42 41