Gene Information

Name : COB47_1098 (COB47_1098)
Accession : YP_003840383.1
Strain : Caldicellulosiruptor obsidiansis OB47
Genome accession: NC_014392
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1216087 - 1216758 bp
Length : 672 bp
Strand : +
Note : KEGG: ate:Athe_1456 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGAAAATCCTTGTTATTGATGATGATATAAAGATATGTGAGGTAATAAAACTCTACTTAGAAAAAGAAGGGTTTGAAGT
GGTAGTTACTCACAATGGTATGGATGGAATTTCTGTTTTCAAAAATGAAATGCCCGACCTGGTTATATTAGATATTATGT
TGCCCAAAAAAGATGGATATGAGGTTTGTAGAGAACTCAGAAAGATTAGTAACATTCCAATTATAATGCTCACTGCTAAA
GGAGAGACTTTTGATAAGGTACTTGGATTAGAGTTAGGAGCAGATGACTATATTGTAAAACCGTTTGATCCTAAAGAGTT
AATTGCACGTATAAAAGCAGTACTGAGAAGAACACAGGGTGAAGTCAATGATGAAAAGGTTGTGGTATATCCAAATCTGA
CAGTAAATCTCACTACATATGAGGTGAAACTTGAAGATAAAGTAATAGATATGCCGCCGAAAGAGATAGAGCTTTTGTAT
TTTTTAGCATCGCATCCTAATAAAGTGTTTACCCGTGAACAACTTCTTGACCATATATGGGGTTACAATTTTGTTGGTGA
CACTCGAACAGTTGACGTACACATCAAAAGAATAAGAGAAAAGATCGAAAATAATAAGTATCCTTGGAAGATAAAAACCG
TATGGGGTGTAGGTTATAAATTTGAAATTTAG

Protein sequence :
MKILVIDDDIKICEVIKLYLEKEGFEVVVTHNGMDGISVFKNEMPDLVILDIMLPKKDGYEVCRELRKISNIPIIMLTAK
GETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRRTQGEVNDEKVVVYPNLTVNLTTYEVKLEDKVIDMPPKEIELLY
FLASHPNKVFTREQLLDHIWGYNFVGDTRTVDVHIKRIREKIENNKYPWKIKTVWGVGYKFEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-41 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-53 51
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-49 49
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-51 49
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-51 49
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-46 48
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-51 48
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-51 48
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-51 48
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-51 48
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-51 48
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-51 48
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-51 48
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-51 48
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-45 46
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-42 45
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-34 43
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-46 43
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-39 43
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 3e-38 43
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 4e-38 42
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 4e-38 42
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 1e-37 42
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-41 42
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 2e-40 42
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-32 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-38 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-38 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-38 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-38 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-38 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-38 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-38 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-38 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-40 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-41 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-41 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-41 41
COB47_1098 YP_003840383.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-41 41