Gene Information

Name : bpr_I2833 (bpr_I2833)
Accession : YP_003832145.1
Strain :
Genome accession: NC_014387
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3394282 - 3394983 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
ATGGCAACAAAACAGAAAATCTTAATTGTCGATGATGACAACAACATTGCAGAGCTGATCTCATTGTACCTGATCAAAGA
GTGCTTTGAGACACGAATCTGTAACGATGGCGAATCTGCCATCAACACATTTGATACTTTTGAACCAAATCTGGTACTGC
TCGATCTGATGTTGCCTGGTATCGATGGATATCAGGTCTGCAGAGAGATCAGGACCAAGTCACAGGTTCCTATTATCATG
CTCTCCGCCAAGGGTGAGGTTTTTGATAAGGTGCTTGGACTGGAAATGGGAGCAGATGACTACATGGAGAAGCCCTTTGA
TTCCAAAGAGCTTGTAGCCAGAGTCAAGGCTGTTCTGCGCCGCTACAAACCGCAGGTACAGGAGATTCAGGAATCTGATG
ATAAGGTTGTAAGATATCCTGACCTTGAAATAAATATGACTAATTATTCTGTCAAATATATGGGAGAAAGAGTCGATATG
CCGCCCAAGGAACTGGAACTTTTATACTTTTTGGCAGCATCACCTAACCATGTATTTACAAGAGAGCAGCTTCTTGATCA
GATCTGGGGCTATGAATATATAGGCGATACCAGAACAGTTGATGTTCATATCAAGAGGCTTCGTGAGAAACTCTCAGACC
ATGAGAAATGGCGCCTTGCTACAATTTGGGGAATTGGATACAAATTTGAGGTACAACAGTAA

Protein sequence :
MATKQKILIVDDDNNIAELISLYLIKECFETRICNDGESAINTFDTFEPNLVLLDLMLPGIDGYQVCREIRTKSQVPIIM
LSAKGEVFDKVLGLEMGADDYMEKPFDSKELVARVKAVLRRYKPQVQEIQESDDKVVRYPDLEINMTNYSVKYMGERVDM
PPKELELLYFLAASPNHVFTREQLLDQIWGYEYIGDTRTVDVHIKRLREKLSDHEKWRLATIWGIGYKFEVQQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bpr_I2833 YP_003832145.1 two component system response regulator NC_012469.1.7685629. Protein 9e-51 49
bpr_I2833 YP_003832145.1 two component system response regulator NC_012469.1.7686381. Protein 3e-42 45
bpr_I2833 YP_003832145.1 two component system response regulator NC_002952.2859905.p0 Protein 2e-46 45
bpr_I2833 YP_003832145.1 two component system response regulator NC_009641.5332272.p0 Protein 1e-46 45
bpr_I2833 YP_003832145.1 two component system response regulator NC_013450.8614421.p0 Protein 1e-46 45
bpr_I2833 YP_003832145.1 two component system response regulator NC_007793.3914279.p0 Protein 1e-46 45
bpr_I2833 YP_003832145.1 two component system response regulator NC_007622.3794472.p0 Protein 2e-46 45
bpr_I2833 YP_003832145.1 two component system response regulator NC_002745.1124361.p0 Protein 1e-46 45
bpr_I2833 YP_003832145.1 two component system response regulator NC_009782.5559369.p0 Protein 1e-46 45
bpr_I2833 YP_003832145.1 two component system response regulator NC_002951.3237708.p0 Protein 1e-46 45
bpr_I2833 YP_003832145.1 two component system response regulator NC_003923.1003749.p0 Protein 1e-46 45
bpr_I2833 YP_003832145.1 two component system response regulator NC_002758.1121668.p0 Protein 1e-46 45
bpr_I2833 YP_003832145.1 two component system response regulator HE999704.1.gene2815. Protein 2e-45 45
bpr_I2833 YP_003832145.1 two component system response regulator AE000516.2.gene3505. Protein 4e-43 44
bpr_I2833 YP_003832145.1 two component system response regulator AE015929.1.gene1106. Protein 2e-35 43
bpr_I2833 YP_003832145.1 two component system response regulator AF155139.2.orf0.gene Protein 7e-44 42
bpr_I2833 YP_003832145.1 two component system response regulator NC_014475.1.orf0.gen Protein 1e-38 41
bpr_I2833 YP_003832145.1 two component system response regulator NC_005054.2598277.p0 Protein 1e-38 41
bpr_I2833 YP_003832145.1 two component system response regulator CP004022.1.gene1676. Protein 5e-32 41
bpr_I2833 YP_003832145.1 two component system response regulator BAC0596 Protein 2e-37 41
bpr_I2833 YP_003832145.1 two component system response regulator BAC0039 Protein 9e-38 41
bpr_I2833 YP_003832145.1 two component system response regulator CP001138.1.gene2239. Protein 2e-37 41
bpr_I2833 YP_003832145.1 two component system response regulator CP000034.1.gene2186. Protein 9e-38 41
bpr_I2833 YP_003832145.1 two component system response regulator NC_002695.1.916589.p Protein 6e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bpr_I2833 YP_003832145.1 two component system response regulator VFG1702 Protein 3e-36 41