Gene Information

Name : Toce_1455 (Toce_1455)
Accession : YP_003825830.1
Strain : Thermosediminibacter oceani DSM 16646
Genome accession: NC_014377
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1424467 - 1425150 bp
Length : 684 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: mta:Moth_0827 two component transcriptional regulator; PFAM: response regulator receiver; transcriptiona

DNA sequence :
TTGTCGGAAATAAGGATTCTCGTAGTTGACGACGAAGAGAAAATAGTGGATCTGGTGAAGCTCTATCTGGAAAAAGAAGG
GTTTAAAGTCGACGAAGCCCATGATGGCCAGCAGGCCCTTGACATGATAGCAAAGGGAGAATACAACCTGATTATTCTAG
ACCTTATGCTGCCCGTCATTGACGGGTGGACTGTATGTAAGGAGGTCAGGAAAAAATCCGATATACCCATTATAATGCTG
ACTGCCAGAGGTGAAGAATTTGATAAAGTCCTGGGATTTGAGCTGGGTGCCGACGATTACGTAGTGAAACCCTTCAGTCC
GAGGGAGTTAGTAGCCAGGGTAAAGGCTCTCCTGAGGCGCCTCGGCCCTAAAGGCCCGGAGCAGACGCTGGAATTTCCGG
GGCTTGTCATAGAGCCTGAGTCCCGGACGGTGAGAGCGGACGGCAAAGAAGTGGCTCTCACCCCAAAGGAATTTGATCTT
TTATACTTCCTTGCGAAAAACAAGGAGAAGGTATTTACAAGGGAAAAGCTACTGGAAGAGGTGTGGGGATACGACTTTTT
TGGAAGCCTGAGGACTGTAGACACGCACATTAAGCAGCTCAGGGAAAAACTGGGGAGGAGCAAAGCCGCCTCGTATATCA
CTACGGTCTGGGGAGTTGGGTATAAATTCGAGGTGGTAAAGTGA

Protein sequence :
MSEIRILVVDDEEKIVDLVKLYLEKEGFKVDEAHDGQQALDMIAKGEYNLIILDLMLPVIDGWTVCKEVRKKSDIPIIML
TARGEEFDKVLGFELGADDYVVKPFSPRELVARVKALLRRLGPKGPEQTLEFPGLVIEPESRTVRADGKEVALTPKEFDL
LYFLAKNKEKVFTREKLLEEVWGYDFFGSLRTVDTHIKQLREKLGRSKAASYITTVWGVGYKFEVVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-34 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-35 43
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 8e-32 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-43 50
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 4e-42 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-40 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-40 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-40 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-40 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-40 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-40 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-40 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-40 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-40 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-40 49
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 3e-44 47
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-44 47
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 9e-40 47
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 1e-33 46
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 7e-33 46
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 1e-33 46
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 1e-38 46
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 1e-38 46
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 9e-32 46
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 6e-32 46
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family BAC0039 Protein 9e-32 46
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 4e-32 46
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 9e-33 46
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 2e-36 45
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 9e-39 45
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family BAC0596 Protein 3e-31 45
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 3e-31 45
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-37 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-37 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-37 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-37 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-37 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-37 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-37 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-37 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 4e-34 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 4e-40 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-34 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 2e-32 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 6e-34 44
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 3e-34 43
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 3e-37 43
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 6e-26 43
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 6e-26 43
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 1e-29 43
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family U35369.1.gene1.p01 Protein 3e-32 42
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family AE016830.1.gene2255. Protein 3e-32 42
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 3e-21 42
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family BAC0533 Protein 1e-25 42
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 1e-25 42
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 2e-25 42
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family BAC0125 Protein 5e-34 41
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family BAC0197 Protein 8e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family VFG1563 Protein 2e-36 43
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family VFG1702 Protein 1e-35 43
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family VFG1390 Protein 5e-33 42
Toce_1455 YP_003825830.1 two component transcriptional regulator, winged helix family VFG0596 Protein 6e-31 41