Gene Information

Name : Bresu_0887 (Bresu_0887)
Accession : YP_003817824.1
Strain : Brevundimonas subvibrioides ATCC 15264
Genome accession: NC_014375
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 890157 - 890582 bp
Length : 426 bp
Strand : +
Note : KEGG: met:M446_0521 arsenate reductase; TIGRFAM: arsenate reductase; PFAM: arsenate reductase

DNA sequence : 
ATGGACGTCGTCATCTATCACAACCCGGGTTGCGGCACGTCCCGCAACACCCTGGCCCTGATCCGCCACGTCGGGATCGA
GCCCCATGTGATCGAGTATCTGAGGACCCCGCCGAGCCGGGCCCTGATCACCGAGCTGGCGTCGAGGGCGAGCGTTCCGC
TCCGCGCCCTGTTGCGCGAGAAGGAAGCCGCGTTCGCCGATCTGGGGCTGGGCGATCCCGGGCTGGGCGACGACCGCCTC
CTCGACGCGATCGAGGCCCATCCGGTGCTGCTCAATCGTCCGATCGTCGTGTCGCCTCTCGGCGTCCGGCTGTGTCGCCC
GTCGGAAACGGTGCTGGACCTCCTGCCCGCCGAAGGCCTGCAGCCTTTCACCAAGGAGGACGGAGAGGTCGTGGTCGATG
CCGCGGGACGCCGCGTCCGGTCCTGA

Protein sequence : 
MDVVIYHNPGCGTSRNTLALIRHVGIEPHVIEYLRTPPSRALITELASRASVPLRALLREKEAAFADLGLGDPGLGDDRL
LDAIEAHPVLLNRPIVVSPLGVRLCRPSETVLDLLPAEGLQPFTKEDGEVVVDAAGRRVRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 2e-28 52
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 7e-26 52
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 7e-26 52
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 1e-25 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bresu_0887 YP_003817824.1 arsenate reductase BAC0583 Protein 6e-30 55
Bresu_0887 YP_003817824.1 arsenate reductase BAC0582 Protein 1e-29 54
Bresu_0887 YP_003817824.1 arsenate reductase BAC0584 Protein 3e-30 54
Bresu_0887 YP_003817824.1 arsenate reductase BAC0585 Protein 6e-29 51