
|
Name : Bresu_0670 (Bresu_0670) Accession : YP_003817608.1 Strain : Brevundimonas subvibrioides ATCC 15264 Genome accession: NC_014375 Putative virulence/resistance : Virulence Product : XRE family transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG1476 EC number : - Position : 671269 - 671472 bp Length : 204 bp Strand : + Note : KEGG: pzu:PHZ_c2933 transcriptional regulator,Cro/CI family; PFAM: hypothetical protein; SMART: hypothetical protein DNA sequence : ATGAACAATCGTCTCAAGGTCCTCCGCGCCGAGCGGAACTGGAGCCAGGCCGATCTGGCCGCCGCGCTCGGGGTTTCGCG CCAGACCGTCAATGCTCTGGAGACCGGTCGCTATGACCCGTCCCTTCCGCTCGCCTTCAAGATCGCCCGGGTTTTCGAAC AACCCATCGAATCCATCTTTTCGGACGCAGGAGCCTCGGCATGA Protein sequence : MNNRLKVLRAERNWSQADLAAALGVSRQTVNALETGRYDPSLPLAFKIARVFEQPIESIFSDAGASA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| EF0524 | NP_814301.1 | Cro/CI family transcriptional regulator | Not tested | Not named | Protein | 7e-09 | 52 |
| ef0042 | AAM75247.1 | EF0042 | Virulence | Not named | Protein | 5e-09 | 52 |
| SH2314 | YP_254229.1 | hypothetical protein | Not tested | ¥ðSh1 | Protein | 2e-11 | 46 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Bresu_0670 | YP_003817608.1 | XRE family transcriptional regulator | VFG2175 | Protein | 2e-09 | 52 |
| Bresu_0670 | YP_003817608.1 | XRE family transcriptional regulator | VFG2168 | Protein | 2e-09 | 52 |