Gene Information

Name : Deba_1204 (Deba_1204)
Accession : YP_003807166.1
Strain : Desulfarculus baarsii DSM 2075
Genome accession: NC_014365
Putative virulence/resistance : Resistance
Product : small multidrug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1356442 - 1356771 bp
Length : 330 bp
Strand : -
Note : COGs: COG2076 Membrane transporter of cations and cationic drugs; InterPro IPR000390; KEGG: bbr:BB3914 membrane transport protein; PFAM: small multidrug resistance protein; SPTR: C0N1Z3 Multidrug resistance protein, SMR family; manually curated; PFAM: Sma

DNA sequence :
ATGGGATATGTGTATCTTTCCATAGCAATATTTGCAGAAATTGTAGGAACTAGTGCTTTAAAAACGTCGCAAGGTTTTAC
TATATTGGTCCCGAGCATCATAGCCATTGTAGGCTATGGGGCATCATTATATTTTTTGTCGCTTGTGTTAGGAATAATGC
CCGTTGGAATTGCATATGCAATCTGGTCTGGAATTGGGATTACGTTAATTACAATGATAGGCGCCATATGGTTTAATCAA
ATTCCTGATATTCCCGCTATAATCGGAATGTTAATGATAATGTCCGGGGTGGTTATAATAAACGTTTTCTCGAAAACCGT
TAGCCGTTGA

Protein sequence :
MGYVYLSIAIFAEIVGTSALKTSQGFTILVPSIIAIVGYGASLYFLSLVLGIMPVGIAYAIWSGIGITLITMIGAIWFNQ
IPDIPAIIGMLMIMSGVVIINVFSKTVSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 3e-16 48
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 5e-16 48
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 3e-16 48
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 3e-16 48
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-16 48
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 3e-16 48
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-16 48
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-16 48
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-16 48
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 5e-16 48
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-16 48
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 5e-16 48
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 3e-16 48
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-16 48
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 3e-16 48
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 3e-16 48
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-16 48
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 3e-16 48
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 3e-16 48
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-16 48
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-10 43
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 2e-16 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deba_1204 YP_003807166.1 small multidrug resistance protein NC_010410.6003348.p0 Protein 7e-24 57
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0002 Protein 7e-24 57
Deba_1204 YP_003807166.1 small multidrug resistance protein CP001138.1.gene1489. Protein 1e-19 51
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0150 Protein 1e-18 50
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0322 Protein 8e-20 49
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0324 Protein 7e-21 49
Deba_1204 YP_003807166.1 small multidrug resistance protein NC_002695.1.913273.p Protein 2e-18 48
Deba_1204 YP_003807166.1 small multidrug resistance protein CP004022.1.gene1549. Protein 9e-18 48
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0323 Protein 1e-16 48
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0377 Protein 2e-17 47
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0325 Protein 7e-15 45
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0249 Protein 3e-10 45
Deba_1204 YP_003807166.1 small multidrug resistance protein AE000516.2.gene3301. Protein 3e-10 45
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0327 Protein 1e-13 43
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0192 Protein 6e-17 42
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0329 Protein 4e-14 41
Deba_1204 YP_003807166.1 small multidrug resistance protein BAC0139 Protein 2e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deba_1204 YP_003807166.1 small multidrug resistance protein VFG1587 Protein 9e-11 43
Deba_1204 YP_003807166.1 small multidrug resistance protein VFG1586 Protein 8e-17 41