Gene Information

Name : merR (NIDE0064)
Accession : YP_003795780.1
Strain : Candidatus Nitrospira defluvii
Genome accession: NC_014355
Putative virulence/resistance : Resistance
Product : mercuric resistance operon regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 54807 - 55214 bp
Length : 408 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 10915804, 11136469, 11167016, 12446701, 12829265, 15773991, 2305262, 2492496, 2666393; Product type r : regulator

DNA sequence :
ATGGAAGAACCAACCGAAATACTGACAATCGGAGTCTTGGCCGAGGCCGCCGGGGTGAATGTCGAGACGATCCGCTTCTA
TCAACGCAAGGGCCTGATGCAGGAGCCTGACCGGCCACTTGGCGGTATCCGTCGCTACGGGGAGCCGGATTTGGCACGCG
TGCGCTTCATCAAGTCGGCCCAGCGACTAGGGTTCAGCTTGGACGAGATCGGCGACTTGCTGAAGCTCGAGGATGGGTCG
CACTGCACCGAGGCCCGCGAACAGGCCGAACGCAAGCTCGCGGATGTGCGCGCCAAGCTCGCCGATCTTCACCGCATTGA
GGCAGTCCTGGAAGATCTGGTGCAGCGCTGCTGCGCCGCACGGGGACAGGTGCGCTGCCCGATGATCCAGGCACTTCAGG
AGGCGTGA

Protein sequence :
MEEPTEILTIGVLAEAAGVNVETIRFYQRKGLMQEPDRPLGGIRRYGEPDLARVRFIKSAQRLGFSLDEIGDLLKLEDGS
HCTEAREQAERKLADVRAKLADLHRIEAVLEDLVQRCCAARGQVRCPMIQALQEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-44 69
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-41 68
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-41 68
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 5e-41 67
merR AFG30124.1 MerR Not tested PAGI-2 Protein 5e-41 67
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 6e-41 67
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-40 67
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-40 67
merR ACK44535.1 MerR Not tested SGI1 Protein 5e-41 67
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 1e-38 65
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 3e-27 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR YP_003795780.1 mercuric resistance operon regulatory protein BAC0688 Protein 3e-42 70
merR YP_003795780.1 mercuric resistance operon regulatory protein BAC0232 Protein 6e-42 69
merR YP_003795780.1 mercuric resistance operon regulatory protein BAC0687 Protein 6e-42 69
merR YP_003795780.1 mercuric resistance operon regulatory protein BAC0684 Protein 1e-41 67
merR YP_003795780.1 mercuric resistance operon regulatory protein BAC0683 Protein 1e-41 67
merR YP_003795780.1 mercuric resistance operon regulatory protein BAC0686 Protein 8e-42 67
merR YP_003795780.1 mercuric resistance operon regulatory protein BAC0689 Protein 2e-40 67
merR YP_003795780.1 mercuric resistance operon regulatory protein BAC0682 Protein 2e-21 42