Gene Information

Name : CLJU_c30140 (CLJU_c30140)
Accession : YP_003781164.1
Strain : Clostridium ljungdahlii ATCC 49587
Genome accession: NC_014328
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3325789 - 3326517 bp
Length : 729 bp
Strand : -
Note : -

DNA sequence :
GTGGATTTAGTAAGTAATACAGATAAAAAAATATTACTTATAGATGATGAAGAAGATATAACGGATTTAATAGAGGATAT
TTTATTAAAGGAAGGATTTAAGAATATCAAAAAAGCTCATTGTGGTTTGGATGGTGTGAAAATATGCCAGAGTGAAAGGA
CTGATATAGTAGTACTTGATATAATGCTTCCAGATATTGATGGAATAGAGGTATGTAAAAGGATAAGACAATTTTCTTAC
TGTCCAATTTTATTTTTATCTGCAAAAAATAGTGATGTTGATAAAATTGTTGGACTGAGTATGGGAGGGGATGACTACAT
TACCAAACCCTTTAGTCCAAGAGAAATTGCCTTTCGCATTAAGGCACAGCTTAGAAGACAGCAGTATGACGGTATAAAGG
AAGTTAAAAGTAGTGAAAATGAGAATATAATCATTGGCAGCATTACTATTGATAAGTTGCACAGTCAGGTATATAAGGAT
GGTTCAGAAGTAAAACTTACAGCAAAGGAATATAAGCTTCTTTTATATCTGGCAGAAAACTCAAATAAAATAGTCAATAA
GGAAAGATTATGTGAGGTAGTATGGGGAGATGATTATTTTGGATATGATAATACAATCTCCGTTCATATAAGACATTTAA
GAGAAAAGCTTGAGAAAAATCCTTCTAAACCGGAAATTATAGTTACTGTAATAGGACTTGGATACAAACTTGTAAAGAGG
AATGAATAG

Protein sequence :
MDLVSNTDKKILLIDDEEDITDLIEDILLKEGFKNIKKAHCGLDGVKICQSERTDIVVLDIMLPDIDGIEVCKRIRQFSY
CPILFLSAKNSDVDKIVGLSMGGDDYITKPFSPREIAFRIKAQLRRQQYDGIKEVKSSENENIIIGSITIDKLHSQVYKD
GSEVKLTAKEYKLLLYLAENSNKIVNKERLCEVVWGDDYFGYDNTISVHIRHLREKLEKNPSKPEIIVTVIGLGYKLVKR
NE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 1e-32 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLJU_c30140 YP_003781164.1 two-component response regulator NC_012469.1.7685629. Protein 5e-35 45
CLJU_c30140 YP_003781164.1 two-component response regulator EU250284.1.orf4.gene Protein 9e-33 45
CLJU_c30140 YP_003781164.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-32 44
CLJU_c30140 YP_003781164.1 two-component response regulator AF162694.1.orf4.gene Protein 1e-33 44
CLJU_c30140 YP_003781164.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-39 44
CLJU_c30140 YP_003781164.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-39 44
CLJU_c30140 YP_003781164.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-39 44
CLJU_c30140 YP_003781164.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-39 44
CLJU_c30140 YP_003781164.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-39 44
CLJU_c30140 YP_003781164.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-39 44
CLJU_c30140 YP_003781164.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-39 44
CLJU_c30140 YP_003781164.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-39 44
CLJU_c30140 YP_003781164.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-39 44
CLJU_c30140 YP_003781164.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-39 44
CLJU_c30140 YP_003781164.1 two-component response regulator AM180355.1.gene1830. Protein 7e-32 44
CLJU_c30140 YP_003781164.1 two-component response regulator HE999704.1.gene2815. Protein 1e-34 43
CLJU_c30140 YP_003781164.1 two-component response regulator NC_012469.1.7686381. Protein 6e-31 43
CLJU_c30140 YP_003781164.1 two-component response regulator NC_005054.2598277.p0 Protein 2e-32 43
CLJU_c30140 YP_003781164.1 two-component response regulator NC_014475.1.orf0.gen Protein 2e-32 43
CLJU_c30140 YP_003781164.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-23 41
CLJU_c30140 YP_003781164.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-23 41
CLJU_c30140 YP_003781164.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-23 41
CLJU_c30140 YP_003781164.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-23 41
CLJU_c30140 YP_003781164.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-23 41
CLJU_c30140 YP_003781164.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-23 41
CLJU_c30140 YP_003781164.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-23 41
CLJU_c30140 YP_003781164.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-23 41
CLJU_c30140 YP_003781164.1 two-component response regulator AF130997.1.orf0.gene Protein 1e-28 41
CLJU_c30140 YP_003781164.1 two-component response regulator DQ212986.1.gene4.p01 Protein 1e-32 41
CLJU_c30140 YP_003781164.1 two-component response regulator AE015929.1.gene1106. Protein 1e-18 41