Gene Information

Name : CLJU_c19450 (CLJU_c19450)
Accession : YP_003780109.1
Strain : Clostridium ljungdahlii ATCC 49587
Genome accession: NC_014328
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2111708 - 2112409 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
GTGAATGAAAAAATACTTTTAGTAGATGATGAAAAGAGCATTTTAGATGTGCTGACCTATGCATTAAAAAGAGAAGGATA
TTTAGTAGAAAGAGCTTATGATGGAGAGGAAGCACTTCATAAAGTAGATATTTTTAATCCGCATATAGTAATTTTAGATT
TAATGCTCCCTGTAATGAACGGATACGATATTTGTAAAAAGTTAGAAAACAAAAATATTGGGATTATCATGCTTACAGCA
AAAGAAGATATTGTGGACAAGATACTTGGACTTGAATTTGGAGCAGATGATTATATGACGAAACCATTTGACATAAGAGA
ACTTCTTGCAAGAATCAAGTCACTTGTAAGGAGACTTAATAAAACTATTGATGAAAAAAAGGATATCGGTGTCATAACTA
TAAATGATCTTAATATTAATAAAAAAAAGAGAACTGTAAGTATAAAGAATGTTTTGGTAGAGCTTACACCTATGGAATTT
GACCTGCTGTATTTACTCCTTTCAAATCCAGGCATAGTATATTCCAGAGAACAGCTTTTAAATATAATATGGAATATGGA
TTATGTTGGAGGAACGCGAACTGTAGATACACACATTCAAAGGGTAAGGAAAAAGTTAGGTGATAGCTATCAGGATTTAA
TACAAACCGTTTATGGTATTGGATATAAAGGGGTTGACGAATTATTTGAAGATGGGAATTAA

Protein sequence :
MNEKILLVDDEKSILDVLTYALKREGYLVERAYDGEEALHKVDIFNPHIVILDLMLPVMNGYDICKKLENKNIGIIMLTA
KEDIVDKILGLEFGADDYMTKPFDIRELLARIKSLVRRLNKTIDEKKDIGVITINDLNINKKKRTVSIKNVLVELTPMEF
DLLYLLLSNPGIVYSREQLLNIIWNMDYVGGTRTVDTHIQRVRKKLGDSYQDLIQTVYGIGYKGVDELFEDGN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-33 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLJU_c19450 YP_003780109.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-43 48
CLJU_c19450 YP_003780109.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-43 48
CLJU_c19450 YP_003780109.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-43 48
CLJU_c19450 YP_003780109.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-43 48
CLJU_c19450 YP_003780109.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-43 48
CLJU_c19450 YP_003780109.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-43 48
CLJU_c19450 YP_003780109.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-43 48
CLJU_c19450 YP_003780109.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-43 48
CLJU_c19450 YP_003780109.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-43 48
CLJU_c19450 YP_003780109.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-43 48
CLJU_c19450 YP_003780109.1 two-component response regulator HE999704.1.gene2815. Protein 7e-39 44
CLJU_c19450 YP_003780109.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-35 43
CLJU_c19450 YP_003780109.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-35 43
CLJU_c19450 YP_003780109.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-35 43
CLJU_c19450 YP_003780109.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-35 43
CLJU_c19450 YP_003780109.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-35 43
CLJU_c19450 YP_003780109.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-35 43
CLJU_c19450 YP_003780109.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-35 43
CLJU_c19450 YP_003780109.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-35 43
CLJU_c19450 YP_003780109.1 two-component response regulator DQ212986.1.gene4.p01 Protein 6e-35 43
CLJU_c19450 YP_003780109.1 two-component response regulator NC_012469.1.7685629. Protein 7e-38 43
CLJU_c19450 YP_003780109.1 two-component response regulator NC_005054.2598277.p0 Protein 3e-32 42
CLJU_c19450 YP_003780109.1 two-component response regulator NC_014475.1.orf0.gen Protein 3e-32 42
CLJU_c19450 YP_003780109.1 two-component response regulator AM180355.1.gene1830. Protein 2e-34 42
CLJU_c19450 YP_003780109.1 two-component response regulator FJ349556.1.orf0.gene Protein 7e-37 42
CLJU_c19450 YP_003780109.1 two-component response regulator NC_012469.1.7686381. Protein 5e-37 41
CLJU_c19450 YP_003780109.1 two-component response regulator AF155139.2.orf0.gene Protein 2e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLJU_c19450 YP_003780109.1 two-component response regulator VFG1702 Protein 2e-33 42
CLJU_c19450 YP_003780109.1 two-component response regulator VFG1563 Protein 7e-33 41