Gene Information

Name : CLJU_c15800 (CLJU_c15800)
Accession : YP_003779746.1
Strain : Clostridium ljungdahlii ATCC 49587
Genome accession: NC_014328
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1719494 - 1720174 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
TTGGAGAATTTTAGAATCCTTTTAGTAGAAGATGAAAAGCAAATGTCAATGTTTATTCAAATGGAACTTACCCATGAAGG
ATATAAAATTGATGCAGCATATGATGGAAGAGAAGCTTTAGAAAAAGTGGAGGATAAAGAGTATGATTTAATTCTTCTTG
ATATTATGATACCAAATCTAAATGGAATTGAGGTTTGCAGAAGAATAAGGCAATTCTCTCATGTACCTATTATAATGCTG
ACTGCTAAAAGTGATATACCAGACAAGGTTTTAGGACTTGATGCAGGGGCTAATGATTATTTATCTAAACCCTTTGCAAT
AGAGGAATTATTGGCAAGAATACGTGTATATGAAAGAGATAAAGCATTGAAAAATCAAACTGATCAAATTAAAGTAAAAA
ATATTGTCATGGATAATAAAACACATCAGGTTTTAAGAGATGGCAAAGAAATTGAGCTTACCAAAACAGAATATAATCTT
CTTAAAATGCTGTTAATTAATAAAAATATTGTACTTACAAGAGATAAGTTAATTGAGGAAGTATGGGGATATGATTATTC
AGGAGATACCAATGTGGTAGATGTATTTATAAGGTATTTAAGAAGTAAAATTGACAATGAACGTCAAGATAAGCTTATAA
CTACCATAAGAGGTGTAGGATATGTTATCAAAGATAATTAA

Protein sequence :
MENFRILLVEDEKQMSMFIQMELTHEGYKIDAAYDGREALEKVEDKEYDLILLDIMIPNLNGIEVCRRIRQFSHVPIIML
TAKSDIPDKVLGLDAGANDYLSKPFAIEELLARIRVYERDKALKNQTDQIKVKNIVMDNKTHQVLRDGKEIELTKTEYNL
LKMLLINKNIVLTRDKLIEEVWGYDYSGDTNVVDVFIRYLRSKIDNERQDKLITTIRGVGYVIKDN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLJU_c15800 YP_003779746.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-49 54
CLJU_c15800 YP_003779746.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-49 54
CLJU_c15800 YP_003779746.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-49 54
CLJU_c15800 YP_003779746.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-49 54
CLJU_c15800 YP_003779746.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-49 54
CLJU_c15800 YP_003779746.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-49 54
CLJU_c15800 YP_003779746.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-49 54
CLJU_c15800 YP_003779746.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-49 54
CLJU_c15800 YP_003779746.1 two-component response regulator AE015929.1.gene1106. Protein 2e-43 51
CLJU_c15800 YP_003779746.1 two-component response regulator HE999704.1.gene1528. Protein 9e-44 49
CLJU_c15800 YP_003779746.1 two-component response regulator BAC0125 Protein 2e-38 43
CLJU_c15800 YP_003779746.1 two-component response regulator BAC0308 Protein 7e-35 43
CLJU_c15800 YP_003779746.1 two-component response regulator NC_012469.1.7685629. Protein 4e-35 42
CLJU_c15800 YP_003779746.1 two-component response regulator AE000516.2.gene3505. Protein 1e-34 42
CLJU_c15800 YP_003779746.1 two-component response regulator NC_012469.1.7686381. Protein 1e-33 41
CLJU_c15800 YP_003779746.1 two-component response regulator BAC0111 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLJU_c15800 YP_003779746.1 two-component response regulator VFG1390 Protein 1e-43 41
CLJU_c15800 YP_003779746.1 two-component response regulator VFG0596 Protein 1e-37 41