Gene Information

Name : czcR (Hsero_3052)
Accession : YP_003776448.1
Strain : Herbaspirillum seropedicae SmR1
Genome accession: NC_014323
Putative virulence/resistance : Virulence
Product : cobalt/zinc/cadmium resistance two component response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3508607 - 3509278 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGGCCATCCTGGTAATCGAAGACGACCCCAAGACCGGTGACTACCTGCGCAAAGGCTTGCGCGAATCCGGCTATGCCGT
GGACCTGGCCCGCAATGGCGCCGATGGCCTGCACATGGCGCTGGAACAGGACTACGACCTGGTGGTGCTGGACGTGATGC
TGCCCGGGCTGGATGGCTGGCAGGTCATGAGCGCACTGCGCAGCAAGCGCGACCTGCCGGTGCTGTTCTTGACCGCGCGG
GACCATGTGGACGACCGCATCCGTGGGCTGCAGCTGGGTGCGGACGATTATCTGGTCAAGCCCTTTTCCTTCACCGAGCT
GGTGCTGCGCATCCGCACCCTGCTGCGCCGGGGCGTCACGCGCGAGGCCGAGGTCTACGAGATCGCCGACCTGCAGCTGG
ACCATGTGCGCCACAAGGTCACCCGCCAGGGCGTCAACATCGCACTGACCAACAAGGAATTCATGCTGCTGCACCTGCTC
ATCAAGCGTCAGGGCGAAGCGCTTTCGCGCAGCGTGATCGCCTCGCAGATCTGGGACATGAACTTCGACAGCGACACCAA
CGTCGTCGATGTGGCCATCAAGCGCCTGCGCGCCAAGATCGATGCGCCGTTCGACAAGAAACTGATCCACACCGTGCGCA
GCGTGGGCTACATGTTCTCGGAAGAACCATGA

Protein sequence :
MAILVIEDDPKTGDYLRKGLRESGYAVDLARNGADGLHMALEQDYDLVVLDVMLPGLDGWQVMSALRSKRDLPVLFLTAR
DHVDDRIRGLQLGADDYLVKPFSFTELVLRIRTLLRRGVTREAEVYEIADLQLDHVRHKVTRQGVNIALTNKEFMLLHLL
IKRQGEALSRSVIASQIWDMNFDSDTNVVDVAIKRLRAKIDAPFDKKLIHTVRSVGYMFSEEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-62 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-61 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein BAC0125 Protein 7e-69 62
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein BAC0197 Protein 3e-68 62
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein BAC0308 Protein 1e-63 61
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein BAC0083 Protein 1e-65 60
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein BAC0111 Protein 3e-65 58
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein BAC0638 Protein 7e-58 57
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein BAC0347 Protein 2e-56 55
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein Y16952.3.orf35.gene. Protein 5e-26 41
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein AE000516.2.gene3505. Protein 4e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein VFG0596 Protein 3e-62 56
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein VFG1390 Protein 1e-40 45
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein VFG1389 Protein 2e-36 45
czcR YP_003776448.1 cobalt/zinc/cadmium resistance two component response regulator protein VFG1386 Protein 4e-36 42