Gene Information

Name : czcR (Hsero_0015)
Accession : YP_003773453.1
Strain : Herbaspirillum seropedicae SmR1
Genome accession: NC_014323
Putative virulence/resistance : Virulence
Product : response regulator for cobalt/zinc/cadmium resistance transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 23342 - 24049 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
ATGCATATCTTGTTGGTAGAGGACGAACCCAAGTCTGGCGACTACCTGCGCCGTGGCTTGACCGAGTCCGGCTTTGTGGT
GGACTGGGTGCAGACCGGGGTCGATGGCCTGCATAATGCGCGCACGCTGGACTACAAGCTCATCATCCTGGATGTGATGC
TGCCCGGCATGAATGGCTGGGACATCCTGCGCGAACTGCGCCGCACGCATGACACGCCCGTGCTGTTCCTGACCGCGCGC
GACGAGGTGGAAGACCGCGTCAAGGGTCTGGAGCTGGGCGCAGACGATTACCTGGTCAAGCCCTTCGCCTACACCGAACT
GCTGGCGCGGGTGCGCACCCTGCTGCGCCGTGGTCCCAGCCGCGAAGTCGATCTGATCGAATACGACGATGTGGTGCTCG
ATGTCCTGCGCCGCAAAGTGACCCGCGCAGGACAACGCATCGACCTCACCGCCAAGGAATTCGCGCTGCTGCACATGTTG
ATCCGCCGCCCCGGCGAAGTGCTCTCGCGTCCGCAGATCGCCTCCCAGGTCTGGGACATGAACTTCGACAGCGACACCAA
CGTGGTCGACGTCGCCGTGCGTCGCCTGCGCGCCAAGCTCGATGAGGGTTTCGAGAAGAAGCTGCTGCATACGGTCTGGG
GCATGGGCTACGTGTTCGAGGTGCGGGAGGGGCGCGAGGTGCGTGAGGTGCGTGAGGAGCGCCCATGA

Protein sequence :
MHILLVEDEPKSGDYLRRGLTESGFVVDWVQTGVDGLHNARTLDYKLIILDVMLPGMNGWDILRELRRTHDTPVLFLTAR
DEVEDRVKGLELGADDYLVKPFAYTELLARVRTLLRRGPSREVDLIEYDDVVLDVLRRKVTRAGQRIDLTAKEFALLHML
IRRPGEVLSRPQIASQVWDMNFDSDTNVVDVAVRRLRAKLDEGFEKKLLHTVWGMGYVFEVREGREVREVREERP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-54 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-53 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein BAC0197 Protein 8e-69 68
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein BAC0083 Protein 4e-64 65
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein BAC0638 Protein 2e-55 63
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein BAC0111 Protein 8e-61 62
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein BAC0125 Protein 9e-65 62
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein BAC0308 Protein 3e-59 59
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein BAC0347 Protein 1e-53 57
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein NC_010079.5776364.p0 Protein 1e-38 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein NC_002952.2859858.p0 Protein 1e-38 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein NC_007622.3794948.p0 Protein 1e-38 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein AE015929.1.gene1106. Protein 9e-34 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein NC_003923.1003417.p0 Protein 1e-38 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein NC_013450.8614146.p0 Protein 1e-38 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein NC_002951.3238224.p0 Protein 1e-38 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein NC_007793.3914065.p0 Protein 1e-38 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein NC_002758.1121390.p0 Protein 1e-38 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein AE000516.2.gene3505. Protein 1e-28 43
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein HE999704.1.gene1528. Protein 6e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein VFG0596 Protein 7e-55 57
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein VFG1390 Protein 8e-38 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein VFG1386 Protein 6e-36 44
czcR YP_003773453.1 response regulator for cobalt/zinc/cadmium resistance transcription regulator protein VFG1389 Protein 1e-31 44