Gene Information

Name : AMED_8635 (AMED_8635)
Accession : YP_003770732.1
Strain : Amycolatopsis mediterranei U32
Genome accession: NC_014318
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 9469095 - 9469775 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence :
GTGCGCCTGCTGATCGTGGAGGACGAGCGCGAGTTCGCGGAGACGCTGCGGCGGGGGCTGGTCGCCGAGGGCTTCACCGC
CGATGTCGCGCACACCGGCCGGGAAGGCCTCTGGCGGGCGACCGAGCACGCGTACGACGTCGTGGTGCTCGACATCATGC
TGCCCGAGCTGTCCGGTTACGAGGTGCTCAAACGCCTGCGGGCGGCGGAGAACTGGACGCCGGTGCTGATGCTGACGGCC
AAGGACGGCGAATACGACGAAGCCGACGCGTTCGACCTCGGCGCCGACGACTACCTGTCCAAGCCGTTCTCCTTCGTCGT
GCTCATCGCCCGGCTGCGCGCGTTGCTGCGGCGGGGCGCCCCGGCCCGGCCGGCCGTGCTGGAGGCGGGCGACCTGCGGC
TCGACCCGTCCGCCCGTACCGTCCACCGAGGACAGAAGCGGATCGAGCTCACCGCGCGGGAGTTCGGGTTGCTGGAGTTC
CTGCTGCGGCGGACCGGCGCGGCGCTGTCGAAGAACGAGATTCTGAGCCACGTCTGGGACGCGCACTACGACGGCGACGA
GAACGTCGTCGAGGTGTACATCGGCTACCTGCGGCGCAAGATCGATGCGCCGTTCGGCACCCACACCATCGAGACGGTCC
GGGGTGTGGGCTACCGGCTGGTAGACGTTACTCGATCGTAA

Protein sequence :
MRLLIVEDEREFAETLRRGLVAEGFTADVAHTGREGLWRATEHAYDVVVLDIMLPELSGYEVLKRLRAAENWTPVLMLTA
KDGEYDEADAFDLGADDYLSKPFSFVVLIARLRALLRRGAPARPAVLEAGDLRLDPSARTVHRGQKRIELTAREFGLLEF
LLRRTGAALSKNEILSHVWDAHYDGDENVVEVYIGYLRRKIDAPFGTHTIETVRGVGYRLVDVTRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-28 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMED_8635 YP_003770732.1 two-component system response regulator BAC0125 Protein 2e-34 50
AMED_8635 YP_003770732.1 two-component system response regulator BAC0083 Protein 3e-31 48
AMED_8635 YP_003770732.1 two-component system response regulator BAC0308 Protein 4e-31 48
AMED_8635 YP_003770732.1 two-component system response regulator BAC0197 Protein 3e-28 48
AMED_8635 YP_003770732.1 two-component system response regulator BAC0111 Protein 7e-31 46
AMED_8635 YP_003770732.1 two-component system response regulator U82965.2.orf14.gene. Protein 4e-23 46
AMED_8635 YP_003770732.1 two-component system response regulator Y16952.3.orf35.gene. Protein 9e-22 45
AMED_8635 YP_003770732.1 two-component system response regulator BAC0638 Protein 2e-30 45
AMED_8635 YP_003770732.1 two-component system response regulator BAC0347 Protein 1e-24 42
AMED_8635 YP_003770732.1 two-component system response regulator HE999704.1.gene1528. Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMED_8635 YP_003770732.1 two-component system response regulator VFG1390 Protein 3e-33 45
AMED_8635 YP_003770732.1 two-component system response regulator VFG0596 Protein 9e-29 44
AMED_8635 YP_003770732.1 two-component system response regulator VFG1389 Protein 8e-24 42
AMED_8635 YP_003770732.1 two-component system response regulator VFG1386 Protein 1e-26 41