Gene Information

Name : Nwat_2027 (Nwat_2027)
Accession : YP_003761182.1
Strain : Nitrosococcus watsonii C-113
Genome accession: NC_014315
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2215589 - 2216176 bp
Length : 588 bp
Strand : -
Note : PFAM: stress protein; KEGG: noc:Noc_1008 stress protein

DNA sequence :
ATGCCCGTTAAGCTAGTAAAAGGCCAAAAAATTTCTCTTGAAAAAGAGAGTGGCGGGACCTTAAGTAAGATTATCATGGG
GGTGGGTTGGGATGCTGCGGACACGATGAAAAGGGGGCTCTTCGGTTTTGGCGGCGATGGTCGGCGAATCGATTTAGATG
CTTCTTGCGTGCTATTTGACGAGTCAGGCAATGTCCTGGATGCAGTCTGGTTTCGTCAGCTGCAAAGTAAGGATGGAAGT
ATTACCCATACCGGGGATAACCTTACGGGCGAAGGAGAAGGGGATGATGAGCAAATCATCGTGGATTTAACCCGGGTTCC
GGTGAGTGTTAAAAGTTTAGTGTTTGTAGTCAACAATTTTACCGGGCAAAATTTCAGCCGGGTCAAAAACGCTTTCTGTC
GTCTGGTTAATCATAGCAATAACGCGGAAATTGCCCGCTATGACCTAAGCTGCCAAGGAGAGCACAACGCTCAGATAATG
GCGAAGGTTTATCGCCATAATGAGGAGTGGAAAATGCATGCCATTGGTGAGAATGCGAACGGTAGAACTTTTAATGATCT
GCTCCCTGCTATTCGTCCTCATTTATAA

Protein sequence :
MPVKLVKGQKISLEKESGGTLSKIIMGVGWDAADTMKRGLFGFGGDGRRIDLDASCVLFDESGNVLDAVWFRQLQSKDGS
ITHTGDNLTGEGEGDDEQIIVDLTRVPVSVKSLVFVVNNFTGQNFSRVKNAFCRLVNHSNNAEIARYDLSCQGEHNAQIM
AKVYRHNEEWKMHAIGENANGRTFNDLLPAIRPHL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-35 52
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-22 46
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-28 45
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-28 45
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-17 43
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-17 43
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-17 43
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-17 42
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-19 41
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-19 41
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nwat_2027 YP_003761182.1 stress protein BAC0392 Protein 1e-28 45
Nwat_2027 YP_003761182.1 stress protein BAC0390 Protein 9e-20 44
Nwat_2027 YP_003761182.1 stress protein BAC0389 Protein 4e-19 41