Gene Information

Name : Dehly_1313 (Dehly_1313)
Accession : YP_003758924.1
Strain : Dehalogenimonas lykanthroporepellens BL-DC-9
Genome accession: NC_014314
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1293596 - 1294291 bp
Length : 696 bp
Strand : +
Note : KEGG: det:DET0135 DNA-binding response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGGCCAAGATAGCCGTTGTGGAAGATGACCGTAACCTGGCCGACCTGCTGAAGTACAACCTCAGCCGGGAGGGCTTCAG
CGTTGTAACCGCTACCGACGGTAGCGCCGGACTGGCGCTGATTCGCCGGGAGAAACCGGACATCATCATCAGCGACGTCA
TGATGCCGGGAATGGACGGATTTGAGTTGACCCGGACGCTGAGGACGGAAACGACGGCACCGGTACTGCTCCTGACCGCC
CGCAGTGAGGAAATCGATAAGGTGCTGGGACTGGAAATGGGCGCCGATGACTACCTGTCCAAGCCGTTTTCCATGCGGGA
ATTGGTGGCCCGGGTCAAGGCCATGCTGAGACGGCTGGAAATGACCGCCGGGACGGAAGCCGGAATACCGGCCGGATTAA
CGCTCCGGCTGGGCGGGTTGGAACTGGATGCCGAACGTCACCGGTTGACGGTTGGCGGCCAAGAGGTGGAACTGTCGCCC
CGTGAATTTGACCTGCTGGCCTACCTGATGAATAACCGCGGCCGGGTGTTTTCCCGCCAGTCGCTGGTGGACCGGGTGTG
GGGTTACGACTATCCGGGCGACGAACGGACGGTGGACGTCCATGTCCGCTGGCTGAGACAAAAAATAGAGACCGACCCGG
CGCGGCCGCACCACCTGGTGACGGTGCGAGGCGTCGGTTACAAGTTCGAGGAATAA

Protein sequence :
MAKIAVVEDDRNLADLLKYNLSREGFSVVTATDGSAGLALIRREKPDIIISDVMMPGMDGFELTRTLRTETTAPVLLLTA
RSEEIDKVLGLEMGADDYLSKPFSMRELVARVKAMLRRLEMTAGTEAGIPAGLTLRLGGLELDAERHRLTVGGQEVELSP
REFDLLAYLMNNRGRVFSRQSLVDRVWGYDYPGDERTVDVHVRWLRQKIETDPARPHHLVTVRGVGYKFEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-38 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-52 48
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-50 48
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-50 47
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-47 46
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-47 46
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-47 46
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-47 46
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-47 46
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-47 46
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-47 46
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-47 46
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-47 46
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-47 45
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-40 44
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-43 43
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 3e-31 42
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 6e-31 42
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator BAC0533 Protein 4e-31 42
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 6e-31 42
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 4e-31 42
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 3e-37 42
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-31 41
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 2e-33 41
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 8e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator VFG1386 Protein 6e-39 46
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-38 45
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-34 45
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator VFG1702 Protein 9e-38 44
Dehly_1313 YP_003758924.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-35 41