Gene Information

Name : Hden_0295 (Hden_0295)
Accession : YP_003754441.1
Strain : Hyphomicrobium denitrificans ATCC 51888
Genome accession: NC_014313
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator PhoB, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 303975 - 304679 bp
Length : 705 bp
Strand : -
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: xau:Xaut_0202 two component transcriptional regulator; SMART: response regulator receiver; transcription

DNA sequence :
ATGGCCGCCAAGATCATCGTCGTCGAAGACGAAGCACCGCTCGTTGAGCTTCTGAAGTACAATCTCCAGTCCGAAGGCTA
CGACGTCGTGCACGCGGCCGACGGCGAGGAAGCCGAACTGCTCTTGGCGGAACAGAGCTACGACCTTGCGATTCTCGATT
GGATGATTCCGAAAATCTCCGGCATCGAGTTATGCCGGAGACTTCGCAATCGCACCGAGACGCAGAACCTGCCGATCATC
CTGCTGACGGCGCGCGGCGAGGAAGCCGATCGCGTGCGCGGACTGACGACCGGCGCCGACGACTATGTCACCAAGCCTTT
CTCCGTTCAGGAGCTGATGGCACGGATCAAGGCGCTCCTGCGCCGTGCCGCTCCCGAGCGCATGAGCGACATCCTCGTCT
CCGGCGAAATCGTCATGGATCGCGGCGCCCACAAGGTCACGCGCGGCGCACGCGAAGTTCGCCTCGGACCCACCGAATAC
CGGATGCTCGAAGTTTTCATGGAGAGCCCGCGCCGTGTGCTCTCGCGAAATCAGCTTCTCGACCGCGTCTGGGGTCAGTC
GTCCGAAGTCGATGAGCGCACGGTCGACGTCCACATCGGACGTTTGAGAAAATCGCTGATCCGCGGCAACGAAAGTGATC
CGATCCGCACGGTTCGCGGCGCGGGTTACGTGTTCGACGGCCGCGAGGCCGACGCTCCCGTCTAA

Protein sequence :
MAAKIIVVEDEAPLVELLKYNLQSEGYDVVHAADGEEAELLLAEQSYDLAILDWMIPKISGIELCRRLRNRTETQNLPII
LLTARGEEADRVRGLTTGADDYVTKPFSVQELMARIKALLRRAAPERMSDILVSGEIVMDRGAHKVTRGAREVRLGPTEY
RMLEVFMESPRRVLSRNQLLDRVWGQSSEVDERTVDVHIGRLRKSLIRGNESDPIRTVRGAGYVFDGREADAPV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-33 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family AE015929.1.gene1106. Protein 9e-36 44
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_003923.1003417.p0 Protein 4e-38 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_013450.8614146.p0 Protein 4e-38 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_002951.3238224.p0 Protein 4e-38 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_007793.3914065.p0 Protein 4e-38 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_002758.1121390.p0 Protein 4e-38 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_010079.5776364.p0 Protein 4e-38 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_002952.2859858.p0 Protein 4e-38 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_007622.3794948.p0 Protein 4e-38 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_002952.2859905.p0 Protein 5e-35 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_002758.1121668.p0 Protein 4e-35 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_009641.5332272.p0 Protein 4e-35 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_013450.8614421.p0 Protein 4e-35 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_003923.1003749.p0 Protein 5e-35 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_007793.3914279.p0 Protein 4e-35 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_007622.3794472.p0 Protein 4e-35 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_002745.1124361.p0 Protein 4e-35 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_009782.5559369.p0 Protein 4e-35 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family NC_002951.3237708.p0 Protein 4e-35 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family HE999704.1.gene2815. Protein 9e-33 41
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family AE000516.2.gene3505. Protein 5e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family VFG1563 Protein 8e-34 44
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family VFG1702 Protein 5e-34 43
Hden_0295 YP_003754441.1 two component transcriptional regulator PhoB, winged helix family VFG1390 Protein 9e-37 41