Gene Information

Name : RPSI07_1614 (RPSI07_1614)
Accession : YP_003752261.1
Strain : Ralstonia solanacearum PSI07
Genome accession: NC_014311
Putative virulence/resistance : Unknown
Product : transposase, putative InsN transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1641677 - 1642009 bp
Length : 333 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type e : enzyme

DNA sequence :
ATGCTCGCTGTGGAGAGGTGTCTGATGGCCAAGCAACGTCGTTCGTTTTCCCCCGAATTCAAGCAGCAGGTTGCCAGCCT
GGTTCTCGACCAGGGCTACAGCCATATCGAGGCGAGTCGCTCGGTCGACGTCGCCGAGTCGGTGCTGCGGCGGTGGGTGC
AGCAGCTTCAGATGGAGCGCCAGGGCATCACGCCGCACGGCAAGGCCATGACCCCAGATCAGCAGCGTATCCAGGAGCTT
GAGGCGCGCATTGAGCGCCTCGAGCGCGAGAAGGCCATTTTAAAAAAGGCTACCGCGCTCTTGATGTCGGAAGGCATCGA
ACGTACGAGGTAA

Protein sequence :
MLAVERCLMAKQRRSFSPEFKQQVASLVLDQGYSHIEASRSVDVAESVLRRWVQQLQMERQGITPHGKAMTPDQQRIQEL
EARIERLEREKAILKKATALLMSEGIERTR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-23 73
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-15 52
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-14 52
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-14 52
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 8e-13 51
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-13 51
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 8e-13 51
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 8e-13 51
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-14 51
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-14 51
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-14 51
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-14 51
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-14 51
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-14 51
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-14 51
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-14 51
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-14 48
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-14 48
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-12 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPSI07_1614 YP_003752261.1 transposase, putative InsN transposase VFG1553 Protein 9e-16 52
RPSI07_1614 YP_003752261.1 transposase, putative InsN transposase VFG0784 Protein 2e-13 51
RPSI07_1614 YP_003752261.1 transposase, putative InsN transposase VFG1123 Protein 1e-14 51
RPSI07_1614 YP_003752261.1 transposase, putative InsN transposase VFG1485 Protein 1e-14 48