Gene Information

Name : copR (RPSI07_mp0532)
Accession : YP_003749519.1
Strain :
Genome accession: NC_014310
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with CopS, regulation of copper resistance
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 682540 - 683226 bp
Length : 687 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 8449873; Product type r : regulator

DNA sequence :
ATGAAGCTGTTAGTCGTCGAAGACGAAGCCAAGACCGGTGAATACCTCCAGCAGGGCCTGACGGAAGCCGGGTTCGTGGT
GGACCTCGCCCGCAACGGCGTGGACGGCCTGCACCTTGCCATGACGGGCGACTACGACCTGCTGGTGCTCGACGTGATGC
TGCCCGACCTGGACGGCTGGCAGATCGTGCAGTCGCTGCGCGCGGCCGAGCGCGCGGTGCCGGTGCTGTTCCTGACCGCG
CGCGACAGCGTGGGCGACCGGGTCAAGGGGCTCGAGCTCGGTGCCGACGATTACCTGGTCAAGCCGTTCGCCTTCGCGGA
GCTGCTGGCGCGGGTCCGCACCCTGCTGCGCCGGGGCAGCACGCCGGTCGCGCTCGACCGGATCCAGATCGCCGACCTCG
TGCTCGACCTGGCGCGCCGCCGCGCCTCGCGCTCGGGGCAGCGGATCGCGCTGACCAGCAAGGAGTTCGCCCTGCTCGAG
CTGCTGGCCCGCCGCCGCGGCGAGGTGCTGCCGCGCTCGCTGATCGCCTCCCAGGTGTGGGACATGAACTTCGACAGCGA
CACCAACGTGATCGACGTCGCCATCCGCCGGCTGCGCGCGAAGATCGACGACGACTTCGCGCCGAAGCTGATCCAGACGG
TGCGCGGCATGGGCTACGTGCTCGAAGACCCGGAGGACGCGGCGTGA

Protein sequence :
MKLLVVEDEAKTGEYLQQGLTEAGFVVDLARNGVDGLHLAMTGDYDLLVLDVMLPDLDGWQIVQSLRAAERAVPVLFLTA
RDSVGDRVKGLELGADDYLVKPFAFAELLARVRTLLRRGSTPVALDRIQIADLVLDLARRRASRSGQRIALTSKEFALLE
LLARRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDDFAPKLIQTVRGMGYVLEDPEDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-46 61
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-45 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance BAC0111 Protein 1e-63 72
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance BAC0083 Protein 4e-58 71
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance BAC0638 Protein 3e-60 70
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance BAC0308 Protein 2e-53 67
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance BAC0197 Protein 1e-53 66
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance BAC0347 Protein 3e-54 65
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance BAC0125 Protein 2e-50 64
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance NC_002516.2.879194.p Protein 1e-21 42
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance NC_010079.5776364.p0 Protein 6e-24 41
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance NC_002952.2859858.p0 Protein 6e-24 41
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance NC_007622.3794948.p0 Protein 6e-24 41
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance NC_003923.1003417.p0 Protein 6e-24 41
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance NC_013450.8614146.p0 Protein 6e-24 41
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance NC_002951.3238224.p0 Protein 6e-24 41
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance NC_007793.3914065.p0 Protein 6e-24 41
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance NC_002758.1121390.p0 Protein 6e-24 41
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance AE000516.2.gene3505. Protein 2e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance VFG0596 Protein 1e-46 61
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance VFG1390 Protein 3e-33 47
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance VFG1389 Protein 1e-27 47
copR YP_003749519.1 response regulator in two-component regulatory system with CopS, regulation of copper resistance VFG1386 Protein 4e-25 41