Gene Information

Name : fliQ (RPSI07_mp0330)
Accession : YP_003749321.1
Strain :
Genome accession: NC_014310
Putative virulence/resistance : Virulence
Product : FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family
Function : -
COG functional category : N : Cell motility
COG ID : COG1987
EC number : -
Position : 392442 - 392711 bp
Length : 270 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 8282695; Product type s : structure

DNA sequence : 
ATGACACCCGAATACGTGCTGAACATGGCCCGCCAGGCCATGCAGGTCGCGATGATGATCGGCGCGCCGATGCTGCTGGT
GTCGCTCATCGTCGGCCTGCTGGTGGCGGTGTTCCAGGCGGCCACCCAGCTCAACGAGCAGACGCTGTCGTTCATCCCCA
AGCTGCTGGCCGTGGCCGCCACCATGATCCTGGCCGGCCCGTGGGTCCTGGGCGTGATCGTCGACTACACGCGCGACGTG
CTCATCAATATCCCGAACTACGTCAACTGA

Protein sequence : 
MTPEYVLNMARQAMQVAMMIGAPMLLVSLIVGLLVAVFQAATQLNEQTLSFIPKLLAVAATMILAGPWVLGVIVDYTRDV
LINIPNYVN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 4e-08 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ YP_003749321.1 FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family VFG2495 Protein 1e-14 60
fliQ YP_003749321.1 FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family VFG2339 Protein 5e-14 51
fliQ YP_003749321.1 FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family VFG1260 Protein 1e-14 50
fliQ YP_003749321.1 FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family VFG2015 Protein 7e-12 46