Gene Information

Name : RPSI07_mp0298 (RPSI07_mp0298)
Accession : YP_003749290.1
Strain :
Genome accession: NC_014310
Putative virulence/resistance : Resistance
Product : putative transcription regulator, MerR family
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 362352 - 362828 bp
Length : 477 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr : putative regulator

DNA sequence :
ATGAAGATCGGCGAACTCGCGCAGCGCACCGGCGTCAGCATCGAGACCATCCGCTTTTACGAAGCGCAGGGCCTGCTGCC
CCCGCCGGCGCGCGCCGCCAACAACTACCGCGTCTACACGCCCGAGCATGCCGAGCAGCTGGCCTTCATCGCGAAGTGCC
GGTCGCTCGACATGGCACACGCCGAAATCCGGCGGCTGATGGAACTGCAGACCAACCCGCAGGCCTCGTGCAAGGAAATC
AACCGTCTGCTCGACGAGCACCTGCGCCATGTCGAAGCCCGCATCGCCGAGCTGACTGAACTGAAGCGCCAGATCGAGGC
GATCGGGCAGCGGTGCACGACGGCCGCGTCCGTGGCGGAGTGCGGCGTGCTGCAGTCGCTGCATGAAGAGCCGCTGCCGC
TCAAGGGCGCCGATCATCATGCCGACCCTGCGGATGCCGAGCACGCGCATCGGCATATCCGCGGCGTGCATCGCTAG

Protein sequence :
MKIGELAQRTGVSIETIRFYEAQGLLPPPARAANNYRVYTPEHAEQLAFIAKCRSLDMAHAEIRRLMELQTNPQASCKEI
NRLLDEHLRHVEARIAELTELKRQIEAIGQRCTTAASVAECGVLQSLHEEPLPLKGADHHADPADAEHAHRHIRGVHR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 4e-32 50
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 5e-32 50
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 4e-32 50
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-32 50
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 3e-32 50
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 3e-32 50
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-32 50
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 7e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPSI07_mp0298 YP_003749290.1 putative transcription regulator, MerR family BAC0058 Protein 2e-30 50
RPSI07_mp0298 YP_003749290.1 putative transcription regulator, MerR family BAC0301 Protein 3e-26 45