Gene Information

Name : RPSI07_mp1421 (RPSI07_mp1421)
Accession : YP_003750366.1
Strain :
Genome accession: NC_014310
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component system
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1725083 - 1725781 bp
Length : 699 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type r : regulator

DNA sequence : 
ATGACCCCCAACACCGCCATGAACATTCTCGTCATTGAAGACGACGCCCGCGTCTCGGATTTCCTCTCGCGCGGCCTGCG
GGCCGAAGGCTATCGCGTGCTGCTCGCGCGCACCGGCCCCGAAGGCCTGCAACTGGCCCGCACCGGCGAGCCGGCGCTGC
TGCTGCTCGACCTGATGCTGCCCGGCATGAGCGGCCTGGAGCTGTGCCAGACCCTGCGCGCGGAGCGCAACCATGTGCCG
ATCCTGATGCTCACCTCGCTGACCGACATCGACGATCGGGTCACCGGCCTGCGGCTGGGCGCGGACGACTACATGACCAA
GCCCTTCGCGTTCGAAGAACTGCTCGCGCGCATCGAAGCGCTGCTGCGCCGCGGGCGCGAACAGCGGCCGAAGGTCAACG
TGCTGCAGGTGGCCGACCTCGTGCTCGACCGCGAGCGCATGCAGGTGACCCGCGCCGGCAAGCCCATCCCGCTCACCGCC
AAGGAGCTGGCCTTCCTGGAACTGCTGATGAGCGCGCCCGGCCGCATCTACAGCCGCGAGCGCATCCTGTCGAACGTCTG
GGGCGCCAACGAGGATCCGCTGACCAACATCGTGGACGTCTATGTGCGGCGGCTGCGCAGCAAGATCGACGAGGGCCATC
CGGTGCCCTTGCTCAAGACCGTGCGCGGACTCGGCTATCGGCTCGATAGCGAGCCCTGA

Protein sequence : 
MTPNTAMNILVIEDDARVSDFLSRGLRAEGYRVLLARTGPEGLQLARTGEPALLLLDLMLPGMSGLELCQTLRAERNHVP
ILMLTSLTDIDDRVTGLRLGADDYMTKPFAFEELLARIEALLRRGREQRPKVNVLQVADLVLDRERMQVTRAGKPIPLTA
KELAFLELLMSAPGRIYSRERILSNVWGANEDPLTNIVDVYVRRLRSKIDEGHPVPLLKTVRGLGYRLDSEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-27 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-26 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPSI07_mp1421 YP_003750366.1 DNA-binding response regulator in two-component system BAC0083 Protein 2e-29 47
RPSI07_mp1421 YP_003750366.1 DNA-binding response regulator in two-component system BAC0197 Protein 4e-27 47
RPSI07_mp1421 YP_003750366.1 DNA-binding response regulator in two-component system BAC0638 Protein 4e-23 47
RPSI07_mp1421 YP_003750366.1 DNA-binding response regulator in two-component system BAC0111 Protein 5e-32 46
RPSI07_mp1421 YP_003750366.1 DNA-binding response regulator in two-component system BAC0308 Protein 3e-28 46
RPSI07_mp1421 YP_003750366.1 DNA-binding response regulator in two-component system BAC0347 Protein 9e-27 45
RPSI07_mp1421 YP_003750366.1 DNA-binding response regulator in two-component system BAC0125 Protein 2e-30 44
RPSI07_mp1421 YP_003750366.1 DNA-binding response regulator in two-component system HE999704.1.gene1528. Protein 1e-25 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPSI07_mp1421 YP_003750366.1 DNA-binding response regulator in two-component system VFG0596 Protein 2e-27 45
RPSI07_mp1421 YP_003750366.1 DNA-binding response regulator in two-component system VFG1390 Protein 2e-29 44