Gene Information

Name : RPSI07_mp1073 (RPSI07_mp1073)
Accession : YP_003750029.1
Strain :
Genome accession: NC_014310
Putative virulence/resistance : Virulence
Product : putative two-component response regulator transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1300415 - 1301098 bp
Length : 684 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr : putative regulator

DNA sequence :
ATGCACATCCTCTTAATAGAAGACGATCAGAAAGCGGCGCGCCTGCTGGCGAGGGGTTTGCAGGAGGAAGGCTTCGAGGT
GGCGGTCGCGCATTCAGCGGAAGAGGCTCATACATCTCTTTTGGCGACACCCCATCTGGTCATCCTGGACTGGATGCTCC
CGGGCAAGGATGGCATCGCCGTGTGCCGCGAGCTGCGCGAGCGCGATCCCCAGCTTCCCATCCTCATGCTGACGGCCCGC
GACGCGACCGCCGATCGCATTGCCGGCCTGAATACCGGCGCGGACGACTACCTGACCAAGCCCTTCGTCTTCGATGAACT
GCTCGCCCGCGTCCGCGCCTTGCTGCGGCGGGCAAGGCTGGCGCCCGCCGCGCAGCGGGTCATCGGTGACCTCCGGCTCG
ATCCGAATGCACGGGTGGTCACGCGCGGGGGCCATGCGCTCGATATCACGCCCAAGGAATACGCCATCCTCGAATGCCTG
ATGCGCCACGCCGGAGAGACCGTCAGCCGCCTGCAACTGGCCGAGCAGGTCTGGCGCGCCGACCTGATCGCAATCGACAA
TCTCATCGACGTGCACATGAAGAACCTGCGCCGCAAGGTCGATCCGCCCGGCATGCCGGTCCTCATCCATACGGTGCGGG
GCCAAGGCTTTCGCCTGGCGGCGCCGGAGAGCCGGCATGCTTAG

Protein sequence :
MHILLIEDDQKAARLLARGLQEEGFEVAVAHSAEEAHTSLLATPHLVILDWMLPGKDGIAVCRELRERDPQLPILMLTAR
DATADRIAGLNTGADDYLTKPFVFDELLARVRALLRRARLAPAAQRVIGDLRLDPNARVVTRGGHALDITPKEYAILECL
MRHAGETVSRLQLAEQVWRADLIAIDNLIDVHMKNLRRKVDPPGMPVLIHTVRGQGFRLAAPESRHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-25 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-24 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein BAC0083 Protein 5e-29 44
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein BAC0197 Protein 5e-27 44
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein BAC0638 Protein 6e-21 44
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein AE000516.2.gene3505. Protein 3e-27 44
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein BAC0308 Protein 1e-28 43
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein NC_002516.2.879194.p Protein 3e-21 43
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein BAC0125 Protein 4e-28 42
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein BAC0347 Protein 3e-26 42
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein BAC0111 Protein 3e-30 42
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein CP000675.2.gene1535. Protein 4e-19 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein VFG0596 Protein 3e-25 45
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein VFG1390 Protein 2e-29 44
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein VFG0473 Protein 9e-22 42
RPSI07_mp1073 YP_003750029.1 putative two-component response regulator transcription regulator protein VFG1389 Protein 1e-23 42