Gene Information

Name : EbC_27880 (EbC_27880)
Accession : YP_003742166.1
Strain : Erwinia billingiae Eb661
Genome accession: NC_014306
Putative virulence/resistance : Unknown
Product : transposase OrfAB subunit A
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 3109757 - 3110068 bp
Length : 312 bp
Strand : -
Note : silverDB:cbdbB27

DNA sequence :
ATGACCGGACGTAACAGACGCAATTTTAGCCCCGAGTTTCGCCTCGAAGCTGCCCAGCTTGTACTCGATCAGCATTACAC
CGTTGCCGCCGCTGCTACGGCAATGAACGTCGGCAAATCCACAATGGACAAATGGGTTCGACAACTGAAAGAAGAGCGAG
CGGGAAAATCACCCACTGCTTCACCCATGACACCTGAGCAGATTGAAATACGCGAGCTAAAGAAAAGACTTCAACGCGTT
GAAATGGAAAGGGATATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAATTCTCATTAG

Protein sequence :
MTGRNRRNFSPEFRLEAAQLVLDQHYTVAAAATAMNVGKSTMDKWVRQLKEERAGKSPTASPMTPEQIEIRELKKRLQRV
EMERDILKKATALLMSDSLNNSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-34 80
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-34 80
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-34 80
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-34 80
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-34 80
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-34 80
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-34 80
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-34 80
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-33 77
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-27 72
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-31 71
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-31 71
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-26 61
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-25 57
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-25 57
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-24 56
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 6e-24 56
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 6e-24 56
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-24 56
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 7e-21 50
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-14 44
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 4e-17 43
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-16 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EbC_27880 YP_003742166.1 transposase OrfAB subunit A VFG1123 Protein 6e-35 80
EbC_27880 YP_003742166.1 transposase OrfAB subunit A VFG1485 Protein 4e-32 71
EbC_27880 YP_003742166.1 transposase OrfAB subunit A VFG1553 Protein 6e-27 61
EbC_27880 YP_003742166.1 transposase OrfAB subunit A VFG0784 Protein 2e-24 56
EbC_27880 YP_003742166.1 transposase OrfAB subunit A VFG1566 Protein 5e-15 44