Gene Information

Name : Aazo_2741 (Aazo_2741)
Accession : YP_003721731.1
Strain : Nostoc azollae 0708
Genome accession: NC_014248
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2828578 - 2829330 bp
Length : 753 bp
Strand : -
Note : KEGG: npu:Npun_F4214 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGTATACTAGTCACTTAAGTAAATGTTCTGCTAAAGCGGATCTCGGTCAAACCAGCCGCATTCTAGTAGTTGAAGATGA
AGAACTCATCCGGGAAATGCTAGTTCTGGCTTTGGAAGGAGAGGGTTATGAGATTATTACTGCTGCTGATGGCCGCGCAG
CTGTGGAATTTCTCAAAAGTTGCGAATCTAATTCCGGGGAATCACCTTTTGATTTGGTGGTTTTGGATTTAATGCTACCG
CAGATTAATGGACTCGATATTTGCCGCTTGCTGCGTCATCAAGGTAATGCTGTACCGATTTTGATGCTCAGTGCTAAGGG
TAGTGAAACTGACAGAGTTCTAGGTTTAGAGGTTGGTGCAGATGATTACTTAACGAAACCTTTTAGTATGCGGGAGTTGG
TGGCTCGCTGTCGCGCTTTACTGCGTCGTCAACGTTTAAGTAATTTGCCGCTGATACCTGTACTCAAGTATAAAGAGATT
AGTTTAAATCCTCAAGAGTGTCGTGTGTTGGTTCGTGGCAAAGAGGTAAATCTATCACCAAAAGAATTCCGCTTGCTGGA
ACTGTTTATGAGTTATGCTCGTCGGGTATGGTCACGGGAGCAACTGCTAGATCAGGTTTGGGGTCCAGATTTTGTTGGTG
ATAGTAAAACTGTAGATGTTCATATCCGCTGGTTGCGGGAAAAGTTAGAGCAAGACCCCAGCCATCCAGAATATATTGTG
ACTGTGAGAGGTTTTGGCTATAGATTTGGCTAA

Protein sequence :
MYTSHLSKCSAKADLGQTSRILVVEDEELIREMLVLALEGEGYEIITAADGRAAVEFLKSCESNSGESPFDLVVLDLMLP
QINGLDICRLLRHQGNAVPILMLSAKGSETDRVLGLEVGADDYLTKPFSMRELVARCRALLRRQRLSNLPLIPVLKYKEI
SLNPQECRVLVRGKEVNLSPKEFRLLELFMSYARRVWSREQLLDQVWGPDFVGDSKTVDVHIRWLREKLEQDPSHPEYIV
TVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-33 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-33 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-35 46
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-35 46
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-35 46
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-35 46
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-35 46
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-35 46
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-35 46
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-35 46
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-35 46
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-35 46
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 6e-44 43
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-40 43
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-37 42
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-33 42
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-14 42
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-33 44
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-33 44
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-33 42
Aazo_2741 YP_003721731.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-23 42