Gene Information

Name : XNC1_4273 (XNC1_4273)
Accession : YP_003714369.1
Strain : Xenorhabdus nematophila ATCC 19061
Genome accession: NC_014228
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 4110711 - 4111004 bp
Length : 294 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe : enzyme

DNA sequence :
ATGCGCAACGGGTTCAACGGTCTGGCCTCAAAGGTGCAAAACGCACTGAAAGATAATCCGTTCTCCGGGCAGGTCTTCAT
CTTCCGTGGTCGCCGGGGGGATATGCTTAAGGTACTGTGGGCTGATGCCGATGGGTTGTGCCTGTTTACCAAACGGCTTG
AGCGTGGACGCTTCGTCTGGCCGGTGACCCGTGAGGGTAAAGTTCATCTGACTCCCGCCCAACTGTCCATGCTGCTTGAA
GGCATAAACTGGAAACATCCGCAGCGGATGGAACGATCTGGTCTACGGATATAA

Protein sequence :
MRNGFNGLASKVQNALKDNPFSGQVFIFRGRRGDMLKVLWADADGLCLFTKRLERGRFVWPVTREGKVHLTPAQLSMLLE
GINWKHPQRMERSGLRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 9e-39 88
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 9e-39 88
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-38 87
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-36 82
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-36 82
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 9e-22 72
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-30 72
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-30 72
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 5e-30 72
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 5e-30 72
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-30 72
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-30 72
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-30 72
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-30 72
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-30 72
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-30 72
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-30 72
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-30 72
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-30 69
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-29 64
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 7e-28 64
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 7e-28 64
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-29 64
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-28 63
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 6e-24 60

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNC1_4273 YP_003714369.1 transposase VFG1665 Protein 1e-38 87
XNC1_4273 YP_003714369.1 transposase VFG1517 Protein 4e-22 72
XNC1_4273 YP_003714369.1 transposase VFG1709 Protein 9e-31 72
XNC1_4273 YP_003714369.1 transposase VFG0792 Protein 9e-31 72
XNC1_4273 YP_003714369.1 transposase VFG1698 Protein 3e-31 72
XNC1_4273 YP_003714369.1 transposase VFG1052 Protein 2e-30 69
XNC1_4273 YP_003714369.1 transposase VFG1737 Protein 4e-29 63