Gene Information

Name : XNC1_4250 (XNC1_4250)
Accession : YP_003714346.1
Strain : Xenorhabdus nematophila ATCC 19061
Genome accession: NC_014228
Putative virulence/resistance : Virulence
Product : phage-like protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 4090848 - 4091057 bp
Length : 210 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 7511582; Product type h : extrachromosomal origin

DNA sequence :
ATGTCAACGATTACAACATTTAAAGAAAGTCTTATTCGCTTACCCGAAGTTCAGCGCCGAACAGGTTATAGCAAGGCGTG
GATCTACAAACTTATCGGAGATGGTGAATTTCCCAAACAAGTCAAAATTGGAGCTCGCTCAATCGCTTTTATTGAATCGG
AAGTTGATGATTGGATTTCTCAGCGTATATCGGAATCTCGTATTTCATAA

Protein sequence :
MSTITTFKESLIRLPEVQRRTGYSKAWIYKLIGDGEFPKQVKIGARSIAFIESEVDDWISQRISESRIS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 7e-08 46
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-07 46
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 1e-06 46
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 2e-06 46
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 2e-06 46
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 3e-10 45
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 7e-10 45
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 7e-10 45
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 5e-05 44
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 5e-05 44
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 3e-08 42
unnamed CAA21398.1 - Not tested HPI Protein 4e-08 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNC1_4250 YP_003714346.1 phage-like protein VFG1480 Protein 3e-08 46
XNC1_4250 YP_003714346.1 phage-like protein VFG1118 Protein 4e-07 46
XNC1_4250 YP_003714346.1 phage-like protein VFG1141 Protein 2e-10 45