Name : XNC1_4250 (XNC1_4250) Accession : YP_003714346.1 Strain : Xenorhabdus nematophila ATCC 19061 Genome accession: NC_014228 Putative virulence/resistance : Virulence Product : phage-like protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 4090848 - 4091057 bp Length : 210 bp Strand : - Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 7511582; Product type h : extrachromosomal origin DNA sequence : ATGTCAACGATTACAACATTTAAAGAAAGTCTTATTCGCTTACCCGAAGTTCAGCGCCGAACAGGTTATAGCAAGGCGTG GATCTACAAACTTATCGGAGATGGTGAATTTCCCAAACAAGTCAAAATTGGAGCTCGCTCAATCGCTTTTATTGAATCGG AAGTTGATGATTGGATTTCTCAGCGTATATCGGAATCTCGTATTTCATAA Protein sequence : MSTITTFKESLIRLPEVQRRTGYSKAWIYKLIGDGEFPKQVKIGARSIAFIESEVDDWISQRISESRIS |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 7e-08 | 46 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 1e-07 | 46 |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-06 | 46 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-06 | 46 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-06 | 46 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 3e-10 | 45 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 7e-10 | 45 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 7e-10 | 45 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 5e-05 | 44 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 5e-05 | 44 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 3e-08 | 42 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 4e-08 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
XNC1_4250 | YP_003714346.1 | phage-like protein | VFG1480 | Protein | 3e-08 | 46 |
XNC1_4250 | YP_003714346.1 | phage-like protein | VFG1118 | Protein | 4e-07 | 46 |
XNC1_4250 | YP_003714346.1 | phage-like protein | VFG1141 | Protein | 2e-10 | 45 |