Gene Information

Name : XNC1_3626 (XNC1_3626)
Accession : YP_003713760.1
Strain : Xenorhabdus nematophila ATCC 19061
Genome accession: NC_014228
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 3503356 - 3503682 bp
Length : 327 bp
Strand : +
Note : -

DNA sequence :
ATGAAATTGAAACCGACCAAACGCCACGATTCCGTTGAATTTAAGCTGGAAGCGGTTCAGCAGGTTGTTCTCCATCATCA
ACGGGTTATTGATATTGCCCGTTCACTGGCCGTTGATGCCAGTACCTTGAGAAAATGGATCCGCCAGTATAAGGCCGAAA
TACAGGGGGTAACGTCTGCCGGTAAAGCCTTAACGCCCGAACAACGCCAGATACAGGCGTTGGAAAAACAGGTCAGGCGT
CTGGAAAGGGAAAAAGAAATTCTAAAGCAGGCGGCCGTGTTGATGAGCGAGATACGCAGTGGGGCTATTCGTTGCTCACA
CGGCTGA

Protein sequence :
MKLKPTKRHDSVEFKLEAVQQVVLHHQRVIDIARSLAVDASTLRKWIRQYKAEIQGVTSAGKALTPEQRQIQALEKQVRR
LEREKEILKQAAVLMSEIRSGAIRCSHG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 3e-21 59
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-22 58
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-14 55
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-13 45
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-13 45
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-13 45
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-13 45
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-13 45
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-13 45
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-13 45
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-13 45
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-14 45
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 6e-15 45
api80 CAF28554.1 putative transposase Not tested YAPI Protein 3e-10 42
l7045 CAD33744.1 - Not tested PAI I 536 Protein 7e-12 42
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 7e-12 42
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-11 42
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 5e-13 42
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 7e-13 42
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-12 41
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-12 41
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-12 41
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNC1_3626 YP_003713760.1 transposase VFG1521 Protein 1e-21 59
XNC1_3626 YP_003713760.1 transposase VFG1566 Protein 6e-23 58
XNC1_3626 YP_003713760.1 transposase VFG1123 Protein 2e-13 45
XNC1_3626 YP_003713760.1 transposase VFG1485 Protein 3e-12 42
XNC1_3626 YP_003713760.1 transposase VFG0784 Protein 7e-13 41