Name : XNC1_3442 (XNC1_3442) Accession : YP_003713601.1 Strain : Xenorhabdus nematophila ATCC 19061 Genome accession: NC_014228 Putative virulence/resistance : Virulence Product : phage-like protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3341815 - 3342027 bp Length : 213 bp Strand : - Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 15263089 DNA sequence : ATGTCAATAATTACCACACCTAAAGAAAGTCTTATTCGTTTATCAGAAGTTCAACTCAGAACAGGTTACAGTAAGGCGTG GATTTATAGACTTATCGGAGAAGATAAATTCCCGAAGCAAATCAAAATCGGCACTCGCTCAGTTGCTTTTCTTGAATCAG AAGTTGATGGCTGGATAGCTCAACGTATTTCTGAATCTCGCGGTGAAATGTAA Protein sequence : MSIITTPKESLIRLSEVQLRTGYSKAWIYRLIGEDKFPKQIKIGTRSVAFLESEVDGWIAQRISESRGEM |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-09 | 50 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-09 | 50 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 5e-07 | 48 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 4e-07 | 48 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-09 | 44 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 7e-08 | 43 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 5e-08 | 43 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-04 | 41 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-04 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
XNC1_3442 | YP_003713601.1 | phage-like protein | VFG1141 | Protein | 9e-10 | 50 |
XNC1_3442 | YP_003713601.1 | phage-like protein | VFG1480 | Protein | 2e-08 | 43 |