Name : alpA (XNC1_3345) Accession : YP_003713511.1 Strain : Xenorhabdus nematophila ATCC 19061 Genome accession: NC_014228 Putative virulence/resistance : Virulence Product : prophage CP4-57 regulatory protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3268499 - 3268705 bp Length : 207 bp Strand : + Note : Evidence 2b : Function of strongly homologous gene; PubMedId : 7511582; Product type h : extrachromosomal origin DNA sequence : ATGACAATGACAGCACCGAAAGAAAATCTTATTCGTTTGCCCGAAGTTCAGCGCAGAACGGGTTATAGCAAGGCGTGGAT TTACAAACTGATTAGCGATGGGGAATTTCCGAAACAGATTAAACTCGGCTCCCGTTCCATCGCGTTTATTGAATCAGAAA TTGATAACTGGATTGCGCAGCGTATCGCAGGATCACGGGTGGCATAA Protein sequence : MTMTAPKENLIRLPEVQRRTGYSKAWIYKLISDGEFPKQIKLGSRSIAFIESEIDNWIAQRIAGSRVA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 6e-08 | 47 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 8e-08 | 47 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 3e-05 | 45 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 3e-05 | 45 |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-06 | 44 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-06 | 44 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-06 | 44 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 4e-07 | 43 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 2e-07 | 43 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 1e-05 | 42 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 9e-08 | 42 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 1e-07 | 42 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 4e-11 | 42 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-07 | 41 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-07 | 41 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 5e-07 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
alpA | YP_003713511.1 | prophage CP4-57 regulatory protein | VFG1480 | Protein | 2e-08 | 47 |
alpA | YP_003713511.1 | prophage CP4-57 regulatory protein | VFG1118 | Protein | 4e-07 | 44 |
alpA | YP_003713511.1 | prophage CP4-57 regulatory protein | VFG0651 | Protein | 2e-07 | 41 |