Gene Information

Name : terD (XNC1_2963)
Accession : YP_003713140.1
Strain : Xenorhabdus nematophila ATCC 19061
Genome accession: NC_014228
Putative virulence/resistance : Resistance
Product : tellurium resistance protein terD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2949217 - 2949795 bp
Length : 579 bp
Strand : -
Note : Evidence 2b : Function of strongly homologous gene; PubMedId : 12724390; Product type ph : phenotype

DNA sequence :
ATGGGTGTATCTCTTTCTAAAGGCGGTAACGTTTCTCTGAGTAAAGAAGCGCCAACCATGAAAAACGTTCTGATCGGTCT
CGGCTGGGATGCCCGCGCGACTGACGGACAGGACTTCGACCTTGACGCATCTGCTTTCCTGCTGGCAGCAAACGGCAAAG
TACGTGGCGACGCTGATTTCATTTTCTACAACAACCTGAAATCGGCTGACGGCTCTATCATGCACACTGGCGACAACCGT
ACTGGTGAAGGAGACGGCGATGATGAGTCACTGAAAATCAAACTGGATCAAATTCCTGCTGACATCGACAAAGTGGTATT
CGTTGTCACAATCCATGATGCACAGACCCGTCGCCAGAGCTTTGGTCAGGTTTCCGGTGCATTCATCCGTCTGGTTGACG
ACGATACCCAAGTTGAAGTTGCCCGCTATGATCTGACTGAAGATGCGTCTACCGAAACTGCTATGTTGTTCGGTGAACTG
TATCGCCACAACACAGAATGGAAATTCCGTGCTGTAGGTCAAGGCTATGCGGGTGGTCTGGCTTCTGTTTGTGCACAGTA
TGGTATCAATGCTGCTTAA

Protein sequence :
MGVSLSKGGNVSLSKEAPTMKNVLIGLGWDARATDGQDFDLDASAFLLAANGKVRGDADFIFYNNLKSADGSIMHTGDNR
TGEGDGDDESLKIKLDQIPADIDKVVFVVTIHDAQTRRQSFGQVSGAFIRLVDDDTQVEVARYDLTEDASTETAMLFGEL
YRHNTEWKFRAVGQGYAGGLASVCAQYGINAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-72 88
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-72 88
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-72 87
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-54 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-54 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-54 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-52 64

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_003713140.1 tellurium resistance protein terD BAC0389 Protein 3e-72 90
terD YP_003713140.1 tellurium resistance protein terD BAC0390 Protein 8e-57 66