|
Name : XNC1_2349 (XNC1_2349) Accession : YP_003712583.1 Strain : Xenorhabdus nematophila ATCC 19061 Genome accession: NC_014228 Putative virulence/resistance : Unknown Product : transposase Function : - COG functional category : L : Replication, recombination and repair COG ID : COG3436 EC number : - Position : 2293970 - 2294263 bp Length : 294 bp Strand : + Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe : enzyme DNA sequence : ATGCGCAACGGGTTCAACGGTCTGGCCTCAAAGGTGCAAAACGCACTGAAAGATAATCCGTTCTCCGGGCAGGTCTTCAT CTTCCGCGGTCGTCGGGGGGATATGCTTAAGGTACTGTGGGCTGATGCCGATGGGTTGTGCCTGTTTACCAAACGGCTTG AGCGTGGACGCTTCGTCTGGCCGGTGACCCGTGAGGGTAAAGTCCATCTGACTCCCGCCCAACTGTCCATGCTGCTTGAA GGCATAAACTGGAAACACCCGCAGCGGATGGAACAATCTGGTCTACGGATATAA Protein sequence : MRNGFNGLASKVQNALKDNPFSGQVFIFRGRRGDMLKVLWADADGLCLFTKRLERGRFVWPVTREGKVHLTPAQLSMLLE GINWKHPQRMEQSGLRI |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| aec52 | AAW51735.1 | Aec52 | Not tested | AGI-3 | Protein | 2e-38 | 87 |
| unnamed | ADD91739.1 | hypothetical protein | Not tested | PAI-I AL862 | Protein | 2e-38 | 87 |
| pB171ORF50 | CAD66190.1 | ORF50 protein of pB171 | Not tested | PAI III 536 | Protein | 6e-38 | 86 |
| ECO103_3553 | YP_003223420.1 | hypothetical protein | Not tested | LEE | Protein | 2e-36 | 81 |
| Z4316 | NP_289542.1 | hypothetical protein | Not tested | OI-122 | Protein | 2e-36 | 81 |
| l0014 | CAD33776.1 | L0014 protein | Not tested | PAI I 536 | Protein | 8e-22 | 72 |
| hp4 | AAC61716.1 | Hp4 | Not tested | PAI I CFT073 | Protein | 2e-30 | 72 |
| ECs4546 | NP_312573.1 | hypothetical protein | Not tested | LEE | Protein | 3e-30 | 72 |
| unnamed | AAL99258.1 | unknown | Not tested | LEE | Protein | 2e-30 | 72 |
| c3561 | NP_755436.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 8e-31 | 72 |
| unnamed | ACU09438.1 | IS66 family element orf2 | Not tested | LEE | Protein | 2e-30 | 72 |
| ECUMN_3327 | YP_002414007.1 | putative transposase ORF2, IS66 family | Not tested | Not named | Protein | 8e-31 | 72 |
| Z1132 | NP_286667.1 | hypothetical protein | Not tested | TAI | Protein | 5e-30 | 72 |
| Z1571 | NP_287075.1 | hypothetical protein | Not tested | TAI | Protein | 5e-30 | 72 |
| c3578 | NP_755453.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 3e-30 | 72 |
| Z4336 | NP_289561.1 | hypothetical protein | Not tested | OI-122 | Protein | 3e-30 | 72 |
| unnamed | AAC31493.1 | L0014 | Not tested | LEE | Protein | 2e-30 | 72 |
| Z5097 | NP_290248.1 | prophage-associated protein | Not tested | LEE | Protein | 3e-30 | 72 |
| unnamed | AAL08461.1 | unknown | Not tested | SRL | Protein | 4e-30 | 69 |
| BCAM0247 | YP_002232879.1 | putative transposase | Not tested | BcenGI11 | Protein | 6e-24 | 63 |
| Z1160 | NP_286695.1 | hypothetical protein | Not tested | TAI | Protein | 8e-29 | 59 |
| Z1599 | NP_287103.1 | hypothetical protein | Not tested | TAI | Protein | 8e-29 | 59 |
| ECO103_3567 | YP_003223430.1 | hypothetical protein | Not tested | LEE | Protein | 5e-28 | 59 |
| Z4338 | NP_289563.1 | hypothetical protein | Not tested | OI-122 | Protein | 5e-28 | 59 |
| ECUMN_3364 | YP_002414037.1 | putative transposase ORF2, IS66 family | Not tested | Not named | Protein | 1e-28 | 58 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| XNC1_2349 | YP_003712583.1 | transposase | VFG1665 | Protein | 2e-38 | 86 |
| XNC1_2349 | YP_003712583.1 | transposase | VFG1517 | Protein | 3e-22 | 72 |
| XNC1_2349 | YP_003712583.1 | transposase | VFG1698 | Protein | 2e-31 | 72 |
| XNC1_2349 | YP_003712583.1 | transposase | VFG1709 | Protein | 8e-31 | 72 |
| XNC1_2349 | YP_003712583.1 | transposase | VFG0792 | Protein | 8e-31 | 72 |
| XNC1_2349 | YP_003712583.1 | transposase | VFG1052 | Protein | 2e-30 | 69 |
| XNC1_2349 | YP_003712583.1 | transposase | VFG1737 | Protein | 3e-29 | 58 |
