Gene Information

Name : XNC1_0806 (XNC1_0806)
Accession : YP_003711099.1
Strain : Xenorhabdus nematophila ATCC 19061
Genome accession: NC_014228
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 694386 - 694712 bp
Length : 327 bp
Strand : -
Note : -

DNA sequence :
ATGAAATTGAAACCGACCAAACGCCACGATTCCGTTGAATTTAAGCTGGAAGCGGTTCAGCAGGTTGTTCTCCGTCAGCA
ACGGGTTATTGATATCGCCCGTTCACTGGCCGTTGATGCCAGTACCTTGAGAAAATGGATCCGCCAGTATAAGGCCGAAA
TACAGGGGGTAACGCCTGCCGGTAAAGCCTTAACGCCCGAACAACGCCAGATACAGGCGTTGGAAAAACAGGTCAGGCGT
CTGGAAAAGGAAAAAGAAATTCTAAAGCAGGCGGCCGTGTTGATGAGCGAGATACGCAGGGGTGCTATTCGTTGCTCACA
CGGCTGA

Protein sequence :
MKLKPTKRHDSVEFKLEAVQQVVLRQQRVIDIARSLAVDASTLRKWIRQYKAEIQGVTPAGKALTPEQRQIQALEKQVRR
LEKEKEILKQAAVLMSEIRRGAIRCSHG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-19 60
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 7e-18 60
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-14 55
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 46
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 46
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 46
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 46
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-11 46
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-11 46
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-11 46
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-11 46
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-08 44
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 7e-12 43
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-10 43
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-10 43
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 9e-12 43
unnamed AAC31483.1 L0004 Not tested LEE Protein 6e-12 43
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 9e-12 43
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-12 43
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-12 43
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-09 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNC1_0806 YP_003711099.1 transposase VFG1566 Protein 1e-19 60
XNC1_0806 YP_003711099.1 transposase VFG1521 Protein 3e-18 60
XNC1_0806 YP_003711099.1 transposase VFG1123 Protein 5e-12 46
XNC1_0806 YP_003711099.1 transposase VFG1485 Protein 1e-10 43
XNC1_0806 YP_003711099.1 transposase VFG0784 Protein 3e-12 43