Gene Information

Name : Slip_0097 (Slip_0097)
Accession : YP_003701462.1
Strain : Syntrophothermus lipocalidus DSM 12680
Genome accession: NC_014220
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 103597 - 104283 bp
Length : 687 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR011006:IPR001867; KEGG: pth:PTH_2685 response regulator; PFAM: response regulator receiver; transcriptional regulator;

DNA sequence :
ATGGCTTCCACCATTCTCGTCGTAGAAGATGAAGAGCTGGTTCAAGAACTACTGAGATTGTATTTAGAGAAAGAAGGGTA
TGCCGTCGAAGCGGCCTGGGACGGAGAAGAGGCTCTCAGCAAATTCCGGTCGAATAACCCGGACCTCGTAATTCTTGACA
TCATGCTGCCGAAAAAGGATGGCTGGACGGTGTGCCGGGAGATTCGCGCGATGAGCAATGCTCCCATTATCATGCTCACC
GCCAAAGGAGAGGAGTCCGACCGGGTATTGGGGCTGGATTTGGGAGCCGACGACTACGTTTGCAAACCATTCAGCCCCAT
CGAGCTGGTCGCACGGGTCAAAGCCGTGCTGCGCCGTACCTCTTTGGCTAATCAAGATGGAAACAGGGTTTTGTTCTATC
CAGGCCTGACTGTGAATTACGATAGTCACCTGGTTGAGGTTGACGGTCGCAGGGTTTCCCTTACCCCCAAAGAGTTCGAA
TTACTGTGGTTTCTCGCCAGCCATCCTGGGAAGGTGTATAGCAGAGAGCAACTGCTTTCCTACGTGTGGGATTACGATTA
CCTGGGGGACCCCCGCACAGTAGACACCCATATCAAACGGCTAAGAGAAAAGCTGGAATCAGGGGTCAAGCAGCGGTACA
TAAGAACAGTATGGGGACGAGGTTACAAGTTTGAGGTGGCAGAATAG

Protein sequence :
MASTILVVEDEELVQELLRLYLEKEGYAVEAAWDGEEALSKFRSNNPDLVILDIMLPKKDGWTVCREIRAMSNAPIIMLT
AKGEESDRVLGLDLGADDYVCKPFSPIELVARVKAVLRRTSLANQDGNRVLFYPGLTVNYDSHLVEVDGRRVSLTPKEFE
LLWFLASHPGKVYSREQLLSYVWDYDYLGDPRTVDTHIKRLREKLESGVKQRYIRTVWGRGYKFEVAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-37 45
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 1e-28 45
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 9e-32 43
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-30 42
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 8e-29 42
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 8e-29 42
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 8e-29 42
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 8e-29 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-31 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-46 51
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-46 51
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-46 51
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-46 51
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-46 51
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-46 51
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-46 51
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-46 51
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-46 51
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-46 51
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-44 50
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-41 49
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-39 49
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator BAC0039 Protein 4e-39 49
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 4e-39 49
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator BAC0596 Protein 4e-38 49
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 4e-38 49
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 4e-38 49
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-42 48
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-42 48
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 7e-38 48
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 7e-40 47
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 7e-39 46
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 7e-39 46
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-38 46
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 7e-40 46
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-39 46
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 5e-35 45
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 3e-37 45
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-25 44
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 5e-31 44
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-39 44
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-39 44
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 5e-36 44
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-33 44
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 4e-32 43
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 7e-36 43
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 5e-27 43
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-27 43
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 5e-27 43
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-27 43
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-29 43
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 5e-27 43
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 9e-31 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 9e-31 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-34 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-34 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-34 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-34 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-34 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-34 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-34 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-34 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-36 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-34 41
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator AF253562.2.orf0.gene Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator VFG1563 Protein 7e-38 45
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-37 45
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-33 44
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-35 42
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-31 41
Slip_0097 YP_003701462.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-32 41