Gene Information

Name : Arch_1419 (Arch_1419)
Accession : YP_003697740.1
Strain : Arcanobacterium haemolyticum DSM 20595
Genome accession: NC_014218
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1554445 - 1555119 bp
Length : 675 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867:IPR011006; KEGG: mva:Mvan_1752 two component transcriptional regulator; PFAM: response regulator receiver; tran

DNA sequence :
ATGCGCATTCTTGTTGTAGATGACGATCCAGGAATCTCCGAAATGGTGGCAATCCTTCTGGAATCAGAAGGATACGACGT
ATCCGTATGTGCAAACGGATCCAACGTAGTGCCGCTTTTCCGTGCAGAACACCCAGATCTCGTGTTGCTTGACGTGATGT
TGCCGGGGCTCGATGGCGTCTCGGTATGCCGTTTGTTGCGCGAAGAATCCGATGTGCCAATCATCATGATGAGTGCAAAG
ACGGACTCCCTTGATGTCATTGCCGGCCTGGAAGCAGGCGCAGACGATTATGTGACTAAGCCTTTCGAAAACTCGGTTCT
TTTGGCACGCGTGAAAGTCCGCCTGCGCCGCCAAGAAAACGAATCCGAAATTTTGAAGGTTGCGGACTTAAGCATCGATC
TCAAAGCACACGAAGTCAAACGCGGGCACGAAACCGTTCACCTCACTCCGCTCGAATTCGATCTGCTTACTGTACTGGCT
CGTAAGCCATACCAAGTGTTTTCTCGCGAAGAACTCCTTGAACAAGTATGGGGATACCGCCATTCAGCAGATACTCGCCT
GGTTAACGTGCACATTCAGCGCCTGCGCGCCAAAGTGGAACGTGATCCAGAAAACCCGGGCGTCGTGCTCACAGTCCGTG
GCGTAGGCTACCGAGCAGGTGCCGTTAAGGAGTGA

Protein sequence :
MRILVVDDDPGISEMVAILLESEGYDVSVCANGSNVVPLFRAEHPDLVLLDVMLPGLDGVSVCRLLREESDVPIIMMSAK
TDSLDVIAGLEAGADDYVTKPFENSVLLARVKVRLRRQENESEILKVADLSIDLKAHEVKRGHETVHLTPLEFDLLTVLA
RKPYQVFSREELLEQVWGYRHSADTRLVNVHIQRLRAKVERDPENPGVVLTVRGVGYRAGAVKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-65 63
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-36 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-36 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-36 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-36 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-36 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-36 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-36 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-36 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-36 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-36 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 9e-38 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 9e-38 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family BAC0125 Protein 9e-31 41
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 9e-30 41
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family VFG1563 Protein 8e-33 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family VFG1702 Protein 6e-33 42
Arch_1419 YP_003697740.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-25 42