Gene Information

Name : Snov_4044 (Snov_4044)
Accession : YP_003695933.1
Strain : Starkeya novella DSM 506
Genome accession: NC_014217
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4276041 - 4276742 bp
Length : 702 bp
Strand : +
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: azc:AZC_4032 phosphate regulon transcriptional regulatory protein; SMART: response regulator receiver

DNA sequence :
ATGCCGACCAACATTCTGATCGTGGAGGATGAGGAGCCCCTCACCCTCCTCCTGCGCTACAACCTCGAATCCGAAGGCTA
TGCGGTCGACAGCGTCGGCCGCGGCGACGAGGCGGAGACCCGGCTGCGCGAGAGCGTGCCGGACCTCCTGATCCTCGACT
GGATGCTGCCCGGCCTCTCCGGCATCGAATTGTGCCGGCGGCTGCGGGCCCGGCCCGAGACCGAGCGCATGCCGATCCTC
ATGCTCACCGCCCGCGGCGAGGAGACCGAGCGCGTGCGCGGCCTCGCCACCGGCGCCGACGACTATGTGGTGAAGCCCTT
CTCGGTGCCCGAACTGGTGGCGCGGGTGCGCGCGCTGCTGCGCCGGGCCAAGCCCGAGCACATCTCGACGCTGCTGCGCG
CCGGCGACATCGAGCTCGACCGCGAGACCAAGCGGGTGCACCGCGCCGGGCGCGAACTGCATCTCGGGCCGACCGAATTC
CGGCTCTTGGAATTCCTCATGCAGTCGCCGGGCCGGGTCTATTCGCGCGAGCAACTGCTCGACGGCGTGTGGGGCCAGGA
CGTCTATATCGACGAGCGCACGGTCGACGTGCATGTCGGCCGCCTGCGCAAGGCGCTCAACCGCCCGCGCCAGCCCGACC
CGATCCGCACCGTGCGCGGCTCCGGCTACTCGTTCAACGAGATGTTCGCCCGCGCGCATTGA

Protein sequence :
MPTNILIVEDEEPLTLLLRYNLESEGYAVDSVGRGDEAETRLRESVPDLLILDWMLPGLSGIELCRRLRARPETERMPIL
MLTARGEETERVRGLATGADDYVVKPFSVPELVARVRALLRRAKPEHISTLLRAGDIELDRETKRVHRAGRELHLGPTEF
RLLEFLMQSPGRVYSREQLLDGVWGQDVYIDERTVDVHVGRLRKALNRPRQPDPIRTVRGSGYSFNEMFARAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-28 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_012469.1.7685629. Protein 6e-30 43
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-33 42
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_002516.2.879194.p Protein 4e-26 42
Snov_4044 YP_003695933.1 two component transcriptional regulator HE999704.1.gene2815. Protein 9e-33 42
Snov_4044 YP_003695933.1 two component transcriptional regulator BAC0197 Protein 1e-23 42
Snov_4044 YP_003695933.1 two component transcriptional regulator BAC0039 Protein 9e-29 42
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_002695.1.916589.p Protein 5e-29 42
Snov_4044 YP_003695933.1 two component transcriptional regulator CP001138.1.gene2239. Protein 2e-28 42
Snov_4044 YP_003695933.1 two component transcriptional regulator CP000034.1.gene2186. Protein 9e-29 42
Snov_4044 YP_003695933.1 two component transcriptional regulator CP001918.1.gene3444. Protein 6e-29 42
Snov_4044 YP_003695933.1 two component transcriptional regulator BAC0596 Protein 2e-28 42
Snov_4044 YP_003695933.1 two component transcriptional regulator CP000647.1.gene2531. Protein 2e-28 42
Snov_4044 YP_003695933.1 two component transcriptional regulator CP000675.2.gene1535. Protein 3e-30 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-26 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator BAC0308 Protein 2e-23 41
Snov_4044 YP_003695933.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-36 41
Snov_4044 YP_003695933.1 two component transcriptional regulator NC_008702.1.4607594. Protein 7e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snov_4044 YP_003695933.1 two component transcriptional regulator VFG1390 Protein 1e-31 45
Snov_4044 YP_003695933.1 two component transcriptional regulator VFG1563 Protein 1e-28 41
Snov_4044 YP_003695933.1 two component transcriptional regulator VFG1702 Protein 1e-28 41