Gene Information

Name : Ndas_4322 (Ndas_4322)
Accession : YP_003682217.1
Strain :
Genome accession: NC_014210
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5155968 - 5156663 bp
Length : 696 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867:IPR011006:IPR011991; KEGG: tfu:Tfu_2910 response regulator receiver; PFAM: response regulator receiver; transcr

DNA sequence :
GTGACGCGCGTACTCGTTGTCGAGGACGAGGAATCCTACAGCGACGCCCTGTCGTACATGCTGCGCAAGGAGGGCTTCGA
GGTCGCCGTGGCGCCCACCGGGACCGTGGCGTTGGAGACCTTCGACCGTACCGGGGCCGACCTGGTGCTGCTGGACCTGA
TGCTGCCGGGGCTGTCGGGCACCGAGGTGTGCCGGACGCTGCGGCAGAAGTCCAACGTCCCCGTGATCATGCTCACCGCC
AAGGACTCCGAGATCGACAAGGTCGTCGGTCTGGAGCTGGGCGCCGACGACTACGTGACCAAGCCCTTCTCCTCCCGCGA
GCTGGTGGCCCGCATCCGCGCGGTGCTGCGCCGCCGGGGCGAGGACGAGGTCGTGCTGCCCGCCGCCCTGGAGGCCGGTC
CCGTCCGGATGGACGTGGAGCGGCACGTGGTGACGGTGCGCGGCGACAACGTGCAGCTCCCCCTCAAGGAGTTCGAGCTG
CTGGAGGTGCTCCTGCGCAACGCCGGGCGGGTGCTCACCAGGATGCAGCTCATCGACCGCGTGTGGGGCGCCGACTACGT
CGGTGACACCAAGACCCTCGACGTGCACGTCAAGAGGCTGCGCGCCAAGATCGAGGAGGACCCCGGCAGCCCGCGCTACA
TCGTGACCGTCCGCGGTCTGGGCTACAAGTTCGAGCCGGTGACCGTCGACGTCTGA

Protein sequence :
MTRVLVVEDEESYSDALSYMLRKEGFEVAVAPTGTVALETFDRTGADLVLLDLMLPGLSGTEVCRTLRQKSNVPVIMLTA
KDSEIDKVVGLELGADDYVTKPFSSRELVARIRAVLRRRGEDEVVLPAALEAGPVRMDVERHVVTVRGDNVQLPLKEFEL
LEVLLRNAGRVLTRMQLIDRVWGADYVGDTKTLDVHVKRLRAKIEEDPGSPRYIVTVRGLGYKFEPVTVDV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-19 42
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 8e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ndas_4322 YP_003682217.1 two component transcriptional regulator AE000516.2.gene3505. Protein 5e-36 50
Ndas_4322 YP_003682217.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-35 49
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-39 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-35 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-35 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-35 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-35 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-35 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-35 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-35 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-35 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-35 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-35 47
Ndas_4322 YP_003682217.1 two component transcriptional regulator BAC0125 Protein 4e-24 43
Ndas_4322 YP_003682217.1 two component transcriptional regulator AE016830.1.gene1681. Protein 5e-36 43
Ndas_4322 YP_003682217.1 two component transcriptional regulator BAC0308 Protein 9e-23 42
Ndas_4322 YP_003682217.1 two component transcriptional regulator BAC0083 Protein 8e-24 42
Ndas_4322 YP_003682217.1 two component transcriptional regulator BAC0197 Protein 8e-22 42
Ndas_4322 YP_003682217.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-21 41
Ndas_4322 YP_003682217.1 two component transcriptional regulator BAC0111 Protein 3e-23 41
Ndas_4322 YP_003682217.1 two component transcriptional regulator BAC0347 Protein 4e-19 41
Ndas_4322 YP_003682217.1 two component transcriptional regulator NC_012469.1.7686381. Protein 1e-33 41
Ndas_4322 YP_003682217.1 two component transcriptional regulator BAC0638 Protein 4e-13 41
Ndas_4322 YP_003682217.1 two component transcriptional regulator CP000647.1.gene2531. Protein 4e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ndas_4322 YP_003682217.1 two component transcriptional regulator VFG1386 Protein 4e-21 44
Ndas_4322 YP_003682217.1 two component transcriptional regulator VFG1389 Protein 7e-23 44
Ndas_4322 YP_003682217.1 two component transcriptional regulator VFG0596 Protein 6e-20 42
Ndas_4322 YP_003682217.1 two component transcriptional regulator VFG1390 Protein 2e-25 41