Gene Information

Name : Tmath_1647 (Tmath_1647)
Accession : YP_003677364.1
Strain : Thermoanaerobacter mathranii A3
Genome accession: NC_014209
Putative virulence/resistance : Resistance
Product : copper ion binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1636402 - 1636626 bp
Length : 225 bp
Strand : -
Note : KEGG: tte:TTE2466 copper chaperone; TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein

DNA sequence : 
ATGGGCTGGTTTGGACCTAAAGGTGAAACTATTATATTAAATGTTAAGGGGATGACATGTAACCATTGCAAAATGTCTGT
CGAAAGTGCACTAAAAAAGTTAAATGGTGTATCAAAAGCTGTTGTTGACCTTGACAAAGGAAATGTTACGGTAACTTATG
ATCCTTCCAAAGTTTCTATAGATGATATGAAAAAAGCAATTATTGATACAGGATATGAAGTGTAA

Protein sequence : 
MGWFGPKGETIILNVKGMTCNHCKMSVESALKKLNGVSKAVVDLDKGNVTVTYDPSKVSIDDMKKAIIDTGYEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 3e-10 44
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-09 44
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-10 44
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-10 44
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-10 44
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-10 44
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-10 44
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-10 44
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-10 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmath_1647 YP_003677364.1 copper ion binding protein BAC0634 Protein 2e-07 44
Tmath_1647 YP_003677364.1 copper ion binding protein BAC0679 Protein 2e-09 41