Name : Tmath_1647 (Tmath_1647) Accession : YP_003677364.1 Strain : Thermoanaerobacter mathranii A3 Genome accession: NC_014209 Putative virulence/resistance : Resistance Product : copper ion binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1636402 - 1636626 bp Length : 225 bp Strand : - Note : KEGG: tte:TTE2466 copper chaperone; TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein DNA sequence : ATGGGCTGGTTTGGACCTAAAGGTGAAACTATTATATTAAATGTTAAGGGGATGACATGTAACCATTGCAAAATGTCTGT CGAAAGTGCACTAAAAAAGTTAAATGGTGTATCAAAAGCTGTTGTTGACCTTGACAAAGGAAATGTTACGGTAACTTATG ATCCTTCCAAAGTTTCTATAGATGATATGAAAAAAGCAATTATTGATACAGGATATGAAGTGTAA Protein sequence : MGWFGPKGETIILNVKGMTCNHCKMSVESALKKLNGVSKAVVDLDKGNVTVTYDPSKVSIDDMKKAIIDTGYEV |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 2e-10 | 44 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 3e-10 | 44 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 2e-09 | 44 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 3e-10 | 44 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 3e-10 | 44 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 3e-10 | 44 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 4e-10 | 44 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 3e-10 | 44 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 3e-10 | 44 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Tmath_1647 | YP_003677364.1 | copper ion binding protein | BAC0634 | Protein | 2e-07 | 44 |
Tmath_1647 | YP_003677364.1 | copper ion binding protein | BAC0679 | Protein | 2e-09 | 41 |