
|
Name : GC56T3_1446 (GC56T3_1446) Accession : YP_003671036.1 Strain : Geobacillus sp. C56-T3 Genome accession: NC_014206 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : S : Function unknown COG ID : COG1937 EC number : - Position : 1520236 - 1520496 bp Length : 261 bp Strand : + Note : PFAM: protein of unknown function DUF156; KEGG: gyc:GYMC61_2895 protein of unknown function DUF156 DNA sequence : ATGGAATATAATAAAGAGATCAAAAACCGCTTAAAACGGATTGAAGGACAAATTAAAGGCGTCCTTGGCATGATGGAACA AGGGAAAGACTGCAAGAGCGTCGTTTCCCAACTTTCAGCGGCGCGCAATGCCATTGACCGCGCCATTGCGGTGATCGTCA GCACCAATTTGGAACATTGCCTGCGTGAAAGCATGGAAAAAGGAGAAAGCACAGACAGTCTTGTCAAAGAAGCAGTGGAA CTGCTTGTGAAAAGCCGTTAA Protein sequence : MEYNKEIKNRLKRIEGQIKGVLGMMEQGKDCKSVVSQLSAARNAIDRAIAVIVSTNLEHCLRESMEKGESTDSLVKEAVE LLVKSR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SACOL0048 | YP_184958.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 2e-19 | 52 |
| SAPIG0063 | YP_005732873.1 | conserved protein YrkD | Not tested | Type-V SCCmec | Protein | 2e-19 | 52 |
| unnamed | BAB83476.1 | - | Not tested | SCC 12263 | Protein | 3e-17 | 52 |
| unnamed | BAA94324.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 5e-17 | 50 |
| unnamed | BAA82210.2 | - | Not tested | Type-II SCCmec | Protein | 5e-19 | 48 |
| SERP2514 | YP_190056.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 7e-19 | 48 |
| SAV0048 | NP_370572.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 7e-19 | 48 |
| unnamed | BAC57484.1 | hypothetical protein | Not tested | Type-IIIinv SCCmec | Protein | 5e-19 | 48 |
| SA0045 | NP_373285.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 7e-19 | 48 |
| unnamed | BAB47614.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 4e-19 | 48 |
| SAR0047 | YP_039520.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 6e-19 | 48 |
| unnamed | BAA82170.2 | - | Not tested | Type-II SCCmec | Protein | 5e-19 | 46 |
| unnamed | BAA86632.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 2e-19 | 46 |