Gene Information

Name : BMB171_C0388 (BMB171_C0388)
Accession : YP_003662926.1
Strain : Bacillus thuringiensis BMB171
Genome accession: NC_014171
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 452411 - 452989 bp
Length : 579 bp
Strand : +
Note : -

DNA sequence :
ATGGTTATTCAATTACAAAAAGGCCAGAAAATCGATTTAGGTAAGACAAGCCCTGGTTTAACAAAAGCAGTAATTGGTCT
TGGATGGGATATTAAATCTTATGACGGCGGAGCCGATTTCGATTTAGATGCATCTGCCTTTTTATTAGATGCAAACGGAA
AATGTACGAAGGAAACTGATTTTATCTTCTATAATAATTTACAGTCTCCTTGTGGATCTGTTTTACATACAGGAGATAAC
CGTACAGGTGAAGGTGAAGGTGACGATGAGCAACTTGTTGTGGATTTGAAGAAAGTTCCAGCAGATGTGCACAGAATTGC
TATTACAGTTACGATTTATGATGCAGAAGGCCGTAGTCAAAATTTTGGGCAAGTAGGAAATGCGTTTGTTCGTTTAGCGA
ATGAAGAAACGAGTGAAGAAGTTCTTCGTTTTGATTTAGGGGAAGATTTCTCCATCGAAACAGCAGTTGTCTTTTGTGAA
TTATACCGTCATAATGGACAGTGGAAGTTTAATGCAGTAGGAAGTGGATTCCAAGGTGGTTTAGGTGCGCTTGTAAGAGC
GTATGGCTTGGATGCATAG

Protein sequence :
MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGADFDLDASAFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDN
RTGEGEGDDEQLVVDLKKVPADVHRIAITVTIYDAEGRSQNFGQVGNAFVRLANEETSEEVLRFDLGEDFSIETAVVFCE
LYRHNGQWKFNAVGSGFQGGLGALVRAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-47 62
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-43 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-43 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-43 56
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-41 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-41 53
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-41 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-39 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMB171_C0388 YP_003662926.1 tellurium resistance protein TerD BAC0389 Protein 1e-43 58
BMB171_C0388 YP_003662926.1 tellurium resistance protein TerD BAC0390 Protein 1e-42 53