Gene Information

Name : Tbis_0707 (Tbis_0707)
Accession : YP_003651325.1
Strain : Thermobispora bispora DSM 43833
Genome accession: NC_014165
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 782892 - 783560 bp
Length : 669 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: ank:AnaeK_0439 two component transcriptional regulator, winged helix family

DNA sequence :
ATGACCTGCGTACTTCTCGCCGAGGATGACACCTCGATTTCCGAGCCGCTCGCGCGCGCACTGCGCCGGGAGGGCTACCA
GGTCGAGGTGAGCCCTGATGGCCCGCAGGCCCTCGAGAGGGCGCTGTCGGGGGGCATCGATTTGATCGTGCTGGATCTCG
GCCTGCCCGAGATGGACGGGCTCGAGGTCGCCCGCCGTATCCGGGCGGAGGGACACGGCACTCCGGTCCTGATCCTCACC
GCCCGCGTCGACGAGGTCGACACCGTGGTCGGGCTCGACGCCGGTGCCGACGACTATGTGACCAAGCCGTTCCGCCTCGC
CGAGCTGCTCGCTCGGGTACGGGCGCTGCTACGGCGCGGCCAGTCCGAGACACCGGTGGTGCAAGGTGTGCGGATCGACG
CCGATTCGCGCCGGGCCTGGCTCGGGGACAAGGAGCTGCACCTCACCACCAAGGAGTTCGACCTGCTCCGCGTGCTCGTG
CGGGACGCCGGCAAGGTCGTCACCCGCGAGCAGATCATGCGCGAGGTGTGGGACACCAACTGGTGGGGGTCGACCAAGAC
GCTGGACATGCACATCTCGTGGCTGCGCCGCAAGCTGGGCGATGACGCGTCCAAGCCGCGGTACATCACCACGGTCCGGG
GAGTCGGCTTCCGCTTCGAGCGCGATTAG

Protein sequence :
MTCVLLAEDDTSISEPLARALRREGYQVEVSPDGPQALERALSGGIDLIVLDLGLPEMDGLEVARRIRAEGHGTPVLILT
ARVDEVDTVVGLDAGADDYVTKPFRLAELLARVRALLRRGQSETPVVQGVRIDADSRRAWLGDKELHLTTKEFDLLRVLV
RDAGKVVTREQIMREVWDTNWWGSTKTLDMHISWLRRKLGDDASKPRYITTVRGVGFRFERD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-18 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-19 44
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-26 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-26 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-26 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-26 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-26 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-26 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-26 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-26 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-23 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-31 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-31 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-31 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-31 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-31 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-31 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-31 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-31 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-31 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-31 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-22 42
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-15 42
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-16 41
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator VFG0473 Protein 4e-18 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-29 43
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-19 42
Tbis_0707 YP_003651325.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-26 42