Gene Information

Name : Tpau_3286 (Tpau_3286)
Accession : YP_003648210.1
Strain : Tsukamurella paurometabola DSM 20162
Genome accession: NC_014158
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3382809 - 3383495 bp
Length : 687 bp
Strand : -
Note : KEGG: rer:RER_43980 two-component response regulator MprA; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGCGGATTCTGGTGGTCGACGATGACCGTGCGGTTCGCGAGTCGCTGCGGCGCTCGCTCACGTTCAACGGGTACCAGGT
GGACACCGCGGTCGACGGGCAGGACGCGCTGGATCACATCGCGAGCAACCGGCCGGACGCGCTGGTGCTCGACCTGAACA
TGCCCCGTCTGGACGGGCTCGAAGTGTGTCGCCGCCTGCGCAGTGCCGGCGACGATCTGCCGATCCTCGTGCTCACCGCG
CGCGACGGCGTCAGCGATCGGGTCAGTGGGCTCGATGCGGGCGCCGACGACTACCTGCCCAAGCCCTTCGCGCTCGAGGA
GTTGCTGGCGCGGATGCGGGCGCTGTTGCGTCGCGCCGTGCCGGACACCGCTTCGGATAACGAGGTGCTGCGGTTCGAGG
ACCTCACGCTCGATCCGGCCACCCGCGAGGTGAGCCGCGGCGATCGGTCGATCAGCCTCACTCGTACCGAGTTCAGCCTG
CTCGAGATGCTTATGGGCAACCCCCGCCGCGTGCTCACCCGTAGTCGCATCCTGGAGGAGGTGTGGGGCTACGACTTCCC
GACTTCGGGCAATGCGCTGGAGGTGTACGTCGGGTACCTGCGCCGTAAGACCGAGGCCGACGGTGAGCCGCGCCTGATCC
ACACCGTCCGGGGCGTGGGCTACGTCCTGCGCGAGACTCCGCCGTGA

Protein sequence :
MRILVVDDDRAVRESLRRSLTFNGYQVDTAVDGQDALDHIASNRPDALVLDLNMPRLDGLEVCRRLRSAGDDLPILVLTA
RDGVSDRVSGLDAGADDYLPKPFALEELLARMRALLRRAVPDTASDNEVLRFEDLTLDPATREVSRGDRSISLTRTEFSL
LEMLMGNPRRVLTRSRILEEVWGYDFPTSGNALEVYVGYLRRKTEADGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-31 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-34 48
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-28 47
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-32 45
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-38 45
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator BAC0347 Protein 4e-28 44
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-31 44
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-31 43
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-30 43
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 7e-33 43
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 8e-24 42
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-35 41
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-35 41
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-35 41
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-35 41
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-35 41
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-35 41
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-35 41
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-35 41
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 2e-26 41
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 9e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-82 85
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-45 52
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-44 50
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-32 43
Tpau_3286 YP_003648210.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-22 41