Gene Information

Name : Tpau_1076 (Tpau_1076)
Accession : YP_003646047.1
Strain : Tsukamurella paurometabola DSM 20162
Genome accession: NC_014158
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1100540 - 1101226 bp
Length : 687 bp
Strand : +
Note : KEGG: mjl:Mjls_1381 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGGACAGCATGAAACCCCGCATCCTGGTGATCGACGACGATCCGGCGCTGGCGGAGATGCTGACCATCGTGCTGCGCAA
CGAGGGCTTCGACTCCATGGTGGTCGGTGACGGCACGCAGGCGCTCGGCGCCGCCCGCGAGTTCCGGCCCGACCTGGTGC
TGCTCGACCTCATGCTGCCCGGTATGAACGGCATCGACGTGGCCCGCGTGCTGCGCGCCGACTCCAACGTGCCGATCGTG
ATGCTGACCGCGAAGGCCGACACCGTCGACGTGGTGCTCGGACTCGAATCCGGTGCCGACGACTACGTGATCAAGCCGTT
CAAGCCGAAGGAGCTGGTGGCGCGGGTGCGTGCCCGGCTGCGTCGCACCGCCGACGAGCCCAGCGAGTTGCTCTCCATCG
GCAACGTGATCATCGACGTCCCCGCGCACAAGGTCACCCGTGACGGCGAGGTCGTGCCGCTCACCCCCACCGAGTTCGAC
CTGCTGGTCACGATGGCCCGCAAGCCGCGCCAGGTGTTCACCCGCGACGTGCTGCTCGAACAGGTGTGGGGTTACCGGCA
CCCGGCCGACACCCGGCTGGTCAACGTCCACATCCAGCGTCTGCGCGCGAAGATCGAGAAGGATCCGGAGAACCCGGAGA
TCGTGCTCACGCTGAGGGGAGTCGGCTACAAGGCCGGTCCGGCGTGA

Protein sequence :
MDSMKPRILVIDDDPALAEMLTIVLRNEGFDSMVVGDGTQALGAAREFRPDLVLLDLMLPGMNGIDVARVLRADSNVPIV
MLTAKADTVDVVLGLESGADDYVIKPFKPKELVARVRARLRRTADEPSELLSIGNVIIDVPAHKVTRDGEVVPLTPTEFD
LLVTMARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHIQRLRAKIEKDPENPEIVLTLRGVGYKAGPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-87 84
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-41 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-40 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-40 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-40 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-40 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-40 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-40 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-40 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-40 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-40 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 8e-39 43
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-37 43
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-29 43
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 8e-38 42
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-30 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-33 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-33 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-33 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-33 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-33 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-33 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-33 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-33 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-30 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 3e-31 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-26 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 8e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator VFG1389 Protein 9e-29 44
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-29 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-33 41
Tpau_1076 YP_003646047.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-32 41