Gene Information

Name : Tint_3216 (Tint_3216)
Accession : YP_003644870.1
Strain :
Genome accession: NC_014154
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 18089 - 18508 bp
Length : 420 bp
Strand : +
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; KEGG: app:CAP2UW1_4508 MerR family transcriptional regulator; SMART: regulatory protein MerR

DNA sequence : 
ATGGAAATCAGAATTGGCGACCTCGCCAAGCGCTCTGGGTGCGAGGTCGTGACCATCCGCTACTACGAAAAGGAAGGGCT
GCTGCCGAAGCCAGCGCGAAGTGGTGGCAACTTTCGGTTGTACAGCGATGTGCACATCGAGCGTTTGCAGTTCATTCGTC
ATTGCCGTTCGCTTGACATGACGCTGAGCGAAATCAGGATACTGCTGGGCCTACGAGATAACCCTGCTCAGGACTGCGGC
GACGTCAATGCACTACTGGATGTCCATATTCGTCAGACCGAAGAGCGCGTGGAAGCGCTGTTGCAATTGAAGCGGCACTT
GCTCTCGCTGCGTGAAAAATGCTCGGGCGCTCGACGAATAGAGGCATGTGGCATCTTGCAAGGTTTATCAGATTGCGATC
ATCCGGGATGCAACGCATAG

Protein sequence : 
MEIRIGDLAKRSGCEVVTIRYYEKEGLLPKPARSGGNFRLYSDVHIERLQFIRHCRSLDMTLSEIRILLGLRDNPAQDCG
DVNALLDVHIRQTEERVEALLQLKRHLLSLREKCSGARRIEACGILQGLSDCDHPGCNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 5e-31 56
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-27 49
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 2e-27 49
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 2e-27 49
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-27 49
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 6e-27 48
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 4e-27 48
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 4e-27 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_3216 YP_003644870.1 MerR family transcriptional regulator BAC0301 Protein 1e-32 59
Tint_3216 YP_003644870.1 MerR family transcriptional regulator BAC0058 Protein 1e-31 56