Gene Information

Name : Tint_2680 (Tint_2680)
Accession : YP_003644351.1
Strain : Thiomonas intermedia K12
Genome accession: NC_014153
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2852315 - 2853034 bp
Length : 720 bp
Strand : -
Note : KEGG: pna:Pnap_3958 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence : 
ATGCGCATTCTGATTGCCGAAGATGACCGGGTCTTGGCCGACGGCCTGTTGCGCTCTCTGCGCGCTCTGGGTTATGCGGT
TGATCAGGTGGCCGACGGCAACAGCGCCGACGCCGCGCTGCAGTCCAGCGAATTCGATCTGCTGATTCTCGACCTGGGGC
TGCCGCGGCTGTCGGGCTTCGAGGTGCTACGCAAGCTGCGCGCGCGCGGCGCCACCGTGCCGGTGCTCATTCTCACCGCC
GCAGACAGCGTGGAAGACAAGGTGCGCGGCCTCGACCTCGGCGCCGACGACTACATGGCCAAGCCCTTCGCGCTGCAGGA
GCTCGAAGCCCGGGTGCGAGCCCTGTCGCGCCGGGGCATGGGCGGCGCCAGCGCCGTGATCCAGCACGGCCCGCTGCACT
ACGACATCACGGGCCGCGTGGTCACGCTCGACGGTCATGTGGTGGAACTCTCGGCGCGTGAACTCACTCTGCTCGAAGTG
CTGCTGCAGCGCGCCGGGCGGCTGGTGAGCAAGGACCAGCTCGTCGAGCATCTGTGCGTGTGGGGCGAGGAGGTGAGCAC
CAACGCCATCGAGGTGTATGTGCACCGACTGCGCAAGAAGATCGAAGTCGGCCCGGTGCGCATCGCCACGGTGCGCGGTC
TGGGCTACTGTCTGGAGAAAATCGTCCCGGTTGCCGCGCCTTCGGCCGAGTCGGCCACGCCTCCTCGTGCCGATGCCTGA

Protein sequence : 
MRILIAEDDRVLADGLLRSLRALGYAVDQVADGNSADAALQSSEFDLLILDLGLPRLSGFEVLRKLRARGATVPVLILTA
ADSVEDKVRGLDLGADDYMAKPFALQELEARVRALSRRGMGGASAVIQHGPLHYDITGRVVTLDGHVVELSARELTLLEV
LLQRAGRLVSKDQLVEHLCVWGEEVSTNAIEVYVHRLRKKIEVGPVRIATVRGLGYCLEKIVPVAAPSAESATPPRADA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-32 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator BAC0487 Protein 5e-32 46
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-32 46
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-25 46
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-29 44
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-27 43
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-30 42
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 5e-27 41
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 4e-26 41
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 1e-25 41
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-29 41
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator BAC0530 Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-29 44
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-34 44
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-25 42
Tint_2680 YP_003644351.1 winged helix family two component transcriptional regulator VFG0475 Protein 1e-25 41