Gene Information

Name : Tint_1844 (Tint_1844)
Accession : YP_003643542.1
Strain : Thiomonas intermedia K12
Genome accession: NC_014153
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1980293 - 1980970 bp
Length : 678 bp
Strand : +
Note : KEGG: gme:Gmet_0688 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence : 
ATGCGCATTCTCCTGGTTGAAGACGATCACATGCTGGGCGCCGCCACGCGCGAAGCCCTGCGCGACGCCACCCACGCGGT
GGACTGGGTACTCGATGGCGCGTCGGCGCTGAGCGCGGCGCAAGGCGGCGAATACGAGCTGATGCTGCTCGATCTCGGCC
TGCCCAAACGCGACGGTCTGTCGGTGCTGCAGGCGCTGCGGCAGTCAGGCAGCAACCTGCCCATCCTCATCCTCACTGCG
CGCGACGCGCTCGAAGACCGGGTGCGCGGCCTCGACCTGGGCGCAGACGACTATCTGGTCAAACCCTTCGAGAGCGCCGA
GCTGCTGGCGCGTATTCGCGCCGTGGCGCGGCGCCAGGGCGGGCAGGCGCAGCCGGTGCTGTCCAACGGCGTGCTTGAAC
TCGACCCCGTTTCTCGCGAGGTGCGGTTTCAGGGTCAGACGCAGCGTCTGACCGCGCGCGAATACGCCCTGCTCCACGCG
CTATTGCTGCGCCCCGGCGCCATTCTGTCGCGCAGCGAACTCGAAGACCGCATTTACGGCTGGAACGAAGAGGTGGAAAG
CAACGCGGTGGAGTTTCTCATCCACAGCCTGCGCAAAAAACTCGCGCCGGATGTCATCAAAAACGTGCGCGGGGTGGGCT
GGCTGGCGCCGCGCGGCGATACGGACAAGGCGCCATGA

Protein sequence : 
MRILLVEDDHMLGAATREALRDATHAVDWVLDGASALSAAQGGEYELMLLDLGLPKRDGLSVLQALRQSGSNLPILILTA
RDALEDRVRGLDLGADDYLVKPFESAELLARIRAVARRQGGQAQPVLSNGVLELDPVSREVRFQGQTQRLTAREYALLHA
LLLRPGAILSRSELEDRIYGWNEEVESNAVEFLIHSLRKKLAPDVIKNVRGVGWLAPRGDTDKAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-35 44
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_1844 YP_003643542.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-37 44
Tint_1844 YP_003643542.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-34 41
Tint_1844 YP_003643542.1 winged helix family two component transcriptional regulator BAC0288 Protein 2e-26 41
Tint_1844 YP_003643542.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 7e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_1844 YP_003643542.1 winged helix family two component transcriptional regulator VFG0473 Protein 7e-40 46
Tint_1844 YP_003643542.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-28 41
Tint_1844 YP_003643542.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-28 41