Gene Information

Name : Tint_1605 (Tint_1605)
Accession : YP_003643308.1
Strain : Thiomonas intermedia K12
Genome accession: NC_014153
Putative virulence/resistance : Resistance
Product : merR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1719995 - 1720414 bp
Length : 420 bp
Strand : +
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; KEGG: pfs:pQBR0435 putative activator/repressor of mer operon; SMART: regulatory protein MerR

DNA sequence :
ATGCAACTTAATTCAAATGGTTTGACCATCGGCGCCGTCGCCAAGGCGGTCGGCGTCAACGTCGAAACCATCCGGTTCTA
CCAGCGCAAGGGCTTGCTGGGTGAACCCGAGCGAACCCAGGGAAGCTTCCGTCATTACGGGCCCGGTGACGTTGCCCGCC
TGCGTTTCATCAAAACGGCCCAAGGTCTGGGCTTCAGCCTCGACGAGATTGCCGGTTTGCTGCAGCTCGATGACGGCATG
CACTGCGACCAGGCGCGTGAGCTCGGTGAGCGCAAGCTCCGCGATGTGCGCACCAAGCTCGACAACCTCAGGCGCATCGA
GGTGGCGCTGGCCGAGATGATTCGCGCCTGCGCCTGCAGCGATGGATCCATGTCCTGCCCTCTTATCGACGCGCTCCACG
GCGAGGTTCACGCTCCCTGA

Protein sequence :
MQLNSNGLTIGAVAKAVGVNVETIRFYQRKGLLGEPERTQGSFRHYGPGDVARLRFIKTAQGLGFSLDEIAGLLQLDDGM
HCDQARELGERKLRDVRTKLDNLRRIEVALAEMIRACACSDGSMSCPLIDALHGEVHAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-39 64
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-37 60
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-37 60
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-37 60
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-37 60
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 3e-38 60
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 5e-38 60
merR AGK07025.1 MerR Not tested SGI1 Protein 6e-37 59
merR AGK07083.1 MerR Not tested SGI1 Protein 6e-37 59
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 5e-35 57
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 6e-26 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_1605 YP_003643308.1 merR family transcriptional regulator BAC0686 Protein 8e-39 61
Tint_1605 YP_003643308.1 merR family transcriptional regulator BAC0688 Protein 4e-38 60
Tint_1605 YP_003643308.1 merR family transcriptional regulator BAC0232 Protein 2e-37 60
Tint_1605 YP_003643308.1 merR family transcriptional regulator BAC0684 Protein 1e-38 60
Tint_1605 YP_003643308.1 merR family transcriptional regulator BAC0687 Protein 2e-37 60
Tint_1605 YP_003643308.1 merR family transcriptional regulator BAC0683 Protein 4e-38 59
Tint_1605 YP_003643308.1 merR family transcriptional regulator BAC0689 Protein 8e-35 56
Tint_1605 YP_003643308.1 merR family transcriptional regulator BAC0682 Protein 4e-21 41