Gene Information

Name : Tint_1366 (Tint_1366)
Accession : YP_003643083.1
Strain : Thiomonas intermedia K12
Genome accession: NC_014153
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1467595 - 1468323 bp
Length : 729 bp
Strand : -
Note : KEGG: lch:Lcho_1895 osmolarity response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGGACCACGAAAAACCGAAGAAGCTGATGGTCGTCGATGACGACGCGCGCATCCGCGACCTGCTACGTCGCTATCTTTC
CCAAGAAGGTTATGAAGTGTTCGTAGCCGAAGATTCCAAGGCGATGTCGCGCATCATGGTGAAGGAGCGCTTCGACCTGA
TCGTGCTTGATCTGATGCTTCCCGGTGAAGACGGCCTGTCCATTTGCAAGCGTCTGCGCGCCTCCAAAGACCAGACCCCG
ATCATCATGCTGACGGCCAAGGGCGAAGATGTGGATCGCATCATCGGCCTGGAAGTCGGCGCTGACGATTACCTGCCCAA
ACCCTTCAACCCCCGAGAACTCCTCGCCCGCATCAGCGCAGTGCTGCGTCGCCAGCCTTCGCCGGAACTGCCCGGCGCGC
CCTCGCGCGAAGACGAAACCGTGGTGTTCGGCCCCTTCAGCCTCGATCTGGCCCGGCGCGAACTCAGCAAAAACGGCGAA
GTCATCAGCCTGACCACCGGCGAATTCGCCATGCTCAAGGCGCTGGTGCGCCACCCCCGCCAGCCGCTGTCGCGCGACCG
CCTGGCCGAGTTGGCCCGCGGACGCGACTACGAAGCCTTCGACCGCAGCCTTGACGTCGCCATTTCTCGTCTGCGCAAAA
TCATCGAAACCGACGCAGCGCATCCGCGCTACATCCAGACCGTATGGGGCGTGGGCTATGTCTTCGTCCCCGACAACGCC
GAAGGCTGA

Protein sequence :
MDHEKPKKLMVVDDDARIRDLLRRYLSQEGYEVFVAEDSKAMSRIMVKERFDLIVLDLMLPGEDGLSICKRLRASKDQTP
IIMLTAKGEDVDRIIGLEVGADDYLPKPFNPRELLARISAVLRRQPSPELPGAPSREDETVVFGPFSLDLARRELSKNGE
VISLTTGEFAMLKALVRHPRQPLSRDRLAELARGRDYEAFDRSLDVAISRLRKIIETDAAHPRYIQTVWGVGYVFVPDNA
EG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-33 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-72 64
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 1e-45 48
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-34 44
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-35 43
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-38 43
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-30 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 7e-31 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-30 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-30 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-26 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-28 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator BAC0596 Protein 7e-28 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-28 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 9e-29 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 7e-28 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 3e-36 41
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 3e-31 41
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 4e-30 41
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 4e-30 41
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 8e-31 41
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-29 41
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 5e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-33 42
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator VFG1563 Protein 9e-34 41
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-33 41
Tint_1366 YP_003643083.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-27 41